[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL62792.1

[Show Plain Result]


## Summary of Sequence Search
    1::394
    1::115     7e-12  43%  148 aa  PF00535 Glycos_transf_2 "Glycosyl transferase family 2"
    1::394

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxTVVLPTLNEAQALPKVVEELRATGYRDILVVDGGSTDGTVEEAKRLGLRVIGQYGRGKGMALRTALM
PF00535         ---SVIIPTYNEEEYLERCLESLLNQTYPEIIVVDDGSTDGTAEIAEELAIRVIREENLGKAGARNAGLR


                         .         .         *         .         .         .         .:140
query           YVETPYVAVLDADYTYPPAELNKLVPLLRHYDVVIGARxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00535         AAKGDYILFLDADDILDPDFLEKLVAALEEVDVVVGSR--------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00535         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00535         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00535         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00535         --------------------------------------------