[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL62997.1

[Show Plain Result]


## Summary of Sequence Search
    1::379
   16::228     3e-21  41%  229 aa  PF01189 Nol1_Nop2_Fmu "NOL1/NOP2/sun family"
   22::95      3e-06  34%  156 aa  PF03848 TehB "Tellurite resistance protein TehB"
   11::71      9e-06  33%   74 aa  PF01472 PUA "PUA domain"
    1::379

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01189         ----------------------------------------------------------------------
PF03848         ----------------------------------------------------------------------
PF01472         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxESVMLGADLYAPAVIKTDRVNIGDEVNIVSDNGRVVALGVAV
PF01189         ----------------------------------------------------------------------
PF03848         ----------------------------------------------------------------------
PF01472         ----------------------------KAVLRGASLLAPGVVSVEGFEKGDVVAVVVEDGRAIAVGLAN


                         +         .         .         .         .         *         .:210
query           MDSDEALKARRGLYIKVExxxxxxxxxxNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGK
PF01189         ----------------------------SLPAFEDGAVYVQDLPALLLDQPGERV-----LDLCAAPGGK
PF03848         ------------------------------------------------------------LDLGCGEGRN
PF01472         YSSAEIRRIKGGISVEIE----------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TTHLAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDRDFPKIKAGVALVDPPCTDIGV
PF01189         TTHLAALTGRVVANDIDAKRLKRLKENLKRLGL-FNVVVTNGDARKLDPWLLGGKFDRVLLDAPCSGLGT
PF03848         ALYLAAQGFDVTAVDKSEEAIEKLKRIAEKEGLDIHTIVVDLNNLSLDEEYDFILSTVVLMFLP------
PF01472         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYVIYSTCTLTYIENEGVIEKAGAEIVDAGIEIGAPGWG
PF01189         HPDIKWRRSPEDIEELAELQREILDAALKPGGRLVYSTCSLLPEENEAVVEAFLAELVPVPLAEGPP---
PF03848         ----------------------------------------------------------------------
PF01472         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           CRECRRFLPHVHNTPGFFIAVLxxxxxxx
PF01189         -EGTLRLLPHRHGTDGFFIARL-------
PF03848         -----------------------------
PF01472         -----------------------------