[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL63125.1

[Show Plain Result]


## Summary of Sequence Search
    1::471
   67::160     2e-13  35%  164 aa  PF04055 Radical_SAM "Radical SAM superfamily"
    1::471

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04055         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIRNETAELRMVALTVETRPD
PF04055         --------------------------------------------------LRLAKEDLPGIRITLETNGT


                         +         .         .         .         .         *         .:210
query           FINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAAEVVEATAILKDSAYKVCYHVMPGLPGSDPD
PF04055         LPDPELLDELAELGLDRLAIGLQSLDDEVLKAINRGHTLEEILEAIELLREAGFKVVTHLIVGLPGTDED


                         .         .         .         +         .         .         .:280
query           RDLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04055         EEL-------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04055         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04055         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04055         ---------------------------------------------------