[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL63374.1

[Show Plain Result]


## Summary of Sequence Search
    1::327
    5::139     1e-10  28%  139 aa  PF01565 FAD_binding_4 "FAD binding domain "
    1::327

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRPKSVEELVELMKEANRDRRRLLPICKGSKAHLGPPVEYDEELQLWDMPKVLEVDEEEMVVRTSACISA
PF01565         VRPRSEEEVAAVVKAAREHGLPVVPRGGGHSLLGGAVVRGGVVIDLSRLNGILEVDPDGLTVTVEAGVTL


                         .         .         *         .         .         .         .:140
query           VELQEELRKRGRRLALDPPLFRRSSIGGILSTNFYGPMAYRYMTPRDQLLSVKIVTGKGEFMKFGxxxxx
PF01565         GDLYAALAPHGLLLPVDPGSGIPGTVGGAVAGNGGGPGSLRYGLTRDNVLGLEVVLADGEIVTAG-----


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01565         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01565         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01565         -----------------------------------------------