[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL63439.1

[Show Plain Result]


## Summary of Sequence Search
    1::69
   59::124     5e-04  35%  125 aa  PF00892 EamA "EamA-like transporter family"
    1::69

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGVFGTVIPYRLFSSAVTKIEGARASVIASVEPVLAALWGFLFFKEIPGLLTLTAYALISTAAVVVxxx
PF00892         LGLLGTALAYGLFFYALKYTPASRASALLALEPVFTALLAALLLGERLSLLQWLGIALIVAGVLLV---