[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL63598.1

[Show Plain Result]


## Summary of Sequence Search
    1::102
    1::77      6e-20  63%  101 aa  PF07903 PaRep2a "PaRep2a protein"
    1::102

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxKVVKRLELYYGMCEIAKAVMAEYGIKPDSPVIREYALRRAFRREWRGK
PF07903         ----------------------KVVKRLEEYYGMCQMAKAAKAEYGEKAE-PLISEYALRRAFEGEWRGK


                         .         .         *         .         .         .         .:140
query           PISCFVTDLRASCNVGERRRHFACLTRPxxxx
PF07903         PMSCFVTEKKAVCKVGDKMAAFYVFDTP----