[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL63645.1

[Show Plain Result]


## Summary of Sequence Search
    1::641
    2::182     5e-66  73%  326 aa  PF07775 PaRep2b "PaRep2b protein"
    1::641

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07775         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07775         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxEDYVYRNVTVERWPLDTSGKQPKAVIHFKLGGEEVAYITVYW
PF07775         ----------------------------EDYV----AVERGPLDTSG-QPKAVIRFKLGGEEVAHINVYW


                         .         .         .         +         .         .         .:280
query           TGRELQAQFGGSHENAERLASIIRALGGKAEVKRIGKVWRTWLTTDDIIAIRHDGWLNAVRGFVDELYGK
PF07775         TGKELQAQFGGSREKAERLASILRALGGEAEVKPVGGGWRVQLTTDGITAIRHPEWLNAVRAFVEELHEK


                         .         *         .         .         .         .         +:350
query           GLIDKDKYEQLVRDLETGPNTVKFAGVEFTVNYENKIMVKYHPRNENAKNAAVNALMARGLREGVHFTVT
PF07775         GLISEERYERLLKEIEAGPNTVKFAGVEFSVYYESKIMIRYQPRSEASKNAAVKALKARGLKEGVHFTVK


                         .         .         .         .         *         .         .:420
query           TEGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07775         EPG-------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07775         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07775         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07775         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxx
PF07775         -----------