[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL63787.1

[Show Plain Result]


## Summary of Sequence Search
    1::142
   92::195     6e-06  27%  459 aa  PF00478 IMPDH "IMP dehydrogenase / GMP reductase domain"
    3::53      6e-05  38%   56 aa  PF00571 CBS "CBS domain"
    1::142

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPVDN
PF00478         -----------VTLSPDTTVADALELMERYGISGVPVVEDGKL-LGGIVTIRD--RRFRDDLSEMMTKEN
PF00571         ---------------------------------------------------------------------D


                         .         .         *         .         .         .         .:140
query           IMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKESDxxxxxxxxxxxxxxxxxx
PF00478         LVTAP-----EGTTLEEANEILHKHKIEKLPVVDNGELVGLITVKDIEKAEE------------------
PF00571         LMTREVVTVPPDTTLAEALALMRATRVSRLPVVDDGKLVGIVTLRDILR---------------------


                         +         .         .         .         .         *         .:210
query           xx
PF00478         --
PF00571         --