[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL63893.1

[Show Plain Result]


## Summary of Sequence Search
    1::516
    7::514     e-116  45%  522 aa  PF02538 Hydantoinase_B "Hydantoinase B/oxoprolinase"
    1::516

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxELIYRATVYIAEEAGIALRNSAFSPNIRERMDHSVAVLNASGEIVAQAEHIPVHLGSFYVGVKNLFN
PF02538         ---EIFSNRFMSIAEEMGRTLQRTAFSPNIKERLDFSCALFDADGDLVANAPHIPVHLGSMSEAVKAVIE


                         .         .         *         .         .         .         .:140
query           ALREAGVELEEGDVVALNDPYISGTHLNDVMVVTPVFWRGRLVAYIVNKAHHVDVGGPVPGSINPSAKTI
PF02538         YWKGG---LKPGDVFITNDPYAGGTHLPDITVITPVFHDGELVFFVASRGHHADIGGIVPGSMPPDATEI


                         +         .         .         .         .         *         .:210
query           YEEGFVLPPVKIIKRGEVNKEALSIWLSNVKTPEATIGDLNAQIAANRVGTRRIVELFDKYGALVEEAWK
PF02538         FEEGLRIPPVKLVERGVFNEDLLRLLLRNTRNPDDNLGDLKAQIAANRKGIRRLQELIDEYGLDTVQAYM


                         .         .         .         +         .         .         .:280
query           RAIEYGRLMTQSEISKWPRGVYVAEDYLELGDKFLKIAVRLTIGECVEANYSGTDPQVDAPLNAVLGVTY
PF02538         DAIQNAEEAVRRLIAALPDGTYEFEDYDDLDDSPIKLKVTIDVGDEATFDFTGTSPQVPGNINAPLAVTK


                         .         *         .         .         .         .         +:350
query           AATSFPIRCLIRGDVPINEGFYSCISVKAPEGSLLNPKRPAAVAGGNLETSQRTADAVFKALAEAMPDKV
PF02538         SAVLYALRCLVDPDIPLNAGCLRPIEVIIPEGSILNPSYPAAVVGGNVETSQRVTDVVLGALAQ----RV


                         .         .         .         .         *         .         .:420
query           PAAGSGTMMNVMMGGVYQGKYWSYYETIXXXXXXXXXXXXVSGVHVNMTNTLNTPIEIAERTYPLLFTAY
PF02538         PAASQGTMNNLTFGGPQDGEGFGYYETIAGGSGAGPGWDGASAVHTHMTNTRITDPEILERRYPVLVERF


                         .         .         +         .         .         .         .:490
query           RIXXXXXXXXXXXXXXXIVRAFKVLAPTRLAILADRFKIGPWGIQGGEAGKPGRAYVKKAGGRTIQLDSK
PF02538         SLRPDSGGAGKYRGGDGVVREIEFLEPMTVSILSERRVFAPWGLAGGEPGAPGRNWVIRADGREEELGGK


                         *         .         .         .         .         +         .:560
query           TITDLEPGDEVVIETPGGGGWGxxxx
PF02538         ATVPLEPGDRLRIETPGGGGYG----