[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL64120.1

[Show Plain Result]


## Summary of Sequence Search
    1::274
    1::156     3e-15  40%  157 aa  PF00881 Nitroreductase "Nitroreductase family"
    1::274

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLA
PF00881         --------------------------------------------------------------------LK


                         .         .         *         .         .         .         .:140
query           NRRSVREFREEPLTLEELGQILWAAYGISETRYGLRTAPSAGAQYPLEVYVVVGEHGVKTGDGYLKPGVY
PF00881         SRRSVRKFDPEPVSDEELEEILEAA----------RLAPSSGNLQPWR-FVVVRDPELKER---LAPAAL


                         +         .         .         .         .         *         .:210
query           HYDPHSHTLTLKKTGDFREALYQAALEQIWVLKAPVSLIFTAVYSRTXXXXXXXXXXXXXPMDLGHAGQN
PF00881         ELLAAAEADA--ETGN-QENLFDAPVVLVVVGKKDY---YTNAYGERGYRWAQ--------LDAGIAAQN


                         .         .         .         +         .         .         .:280
query           VYLQATALGLGTVAVGAFYDDQVAEILDLPDGETPLYIMPIGxxxxxxxxxxxxxxxxxxxxxx
PF00881         LLLAATALGLGSCPIGGFDTDAVRELLGLPENETPLALIAVG----------------------