[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL64265.1

[Show Plain Result]


## Summary of Sequence Search
    1::360
   19::192     6e-10  38%  208 aa  PF01637 Arch_ATPase "Archaeal ATPase"
    1::360

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSALTLILGMRRVGKTSVVKAATYGKLRIYIDARYFEEKRY
PF01637         ------------------------------SRIVLIYGPRGVGKTSLLKEKEKGYRVIYVDA--LEDSEI


                         .         .         *         .         .         .         .:140
query           ISYGDXXXXXXXXXXXXXXXXXXXGELLSKIRGVSVAGVDVKFEIGRNAPSFAEILEAFDQWAREQGERL
PF01637         SSLDEFLKESKKLAEKL-------GIPLPKIGG----------EIKDLEEDAFEALEELLEELAKKGKKV


                         +         .         .         .         .         *         .:210
query           VLIIDEAQELAKLRGRTLLPPLGYAYDNLRNISMVFTGSKAGLLLRFLRLEDPHSPLFGRYFEKIELGPF
PF01637         VIIIDEFQYLAE-EDEDLLSLLQDLLDSQSNLCLVLTGSSDGLM-----EEDYKSPLYGR-ATKIKLKPL


                         .         .         .         +         .         .         .:280
query           SRELSVQFLTKGFEExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01637         SKEEAREFLKDSEED-------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01637         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxx
PF01637         ----------