[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL64389.1

[Show Plain Result]


## Summary of Sequence Search
    1::667
    9::116     4e-26  40%  126 aa  PF03190 DUF255 "Protein of unknown function, DUF255"
   37::97      2e-04  39%  154 aa  PF04905 NCD2 "NAB conserved region 2 (NCD2)"
    1::667

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxVKWWGWCKEAFEAAEREDKPVLVDVGAVWCHWCHVMDERTYNDEEVA
PF03190         -----------------------VDWQPWGEEALAKAKKENKPIFLSIGYDWCHWCHVMEKESFEDPEVA
PF04905         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EFINKHFIPXXXXXXXXXXXXXXLQEAAQLISGQSGWPLTVFMTPKGQVIWAATYLPPRRExxxxxxxxV
PF03190         AYLNENFVPVKVDREERPDIDAIYMNAVQALTGSGGWPLTVFLTPDGKPFFGGTYFPPKDE---------
PF04905         ---------------------------------------------------------------------V


                         +         .         .         .         .         *         .:210
query           LEAVLRAYREKRGEVEKFHEDLARELKKWHSPSPGEPRREGQAEVLAALAASFDEExxxxxxxxxxxxxx
PF03190         ----------------------------------------------------------------------
PF04905         VECVERIFRSPRGDVPKLNKKLARELGHIFEMSENDPRREEEIRKYSAIYGRFDSK--------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03190         ----------------------------------------------------------------------
PF04905         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03190         ----------------------------------------------------------------------
PF04905         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03190         ----------------------------------------------------------------------
PF04905         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03190         ----------------------------------------------------------------------
PF04905         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03190         ----------------------------------------------------------------------
PF04905         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03190         ----------------------------------------------------------------------
PF04905         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03190         -------------------------------------
PF04905         -------------------------------------