[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL64489.1

[Show Plain Result]


## Summary of Sequence Search
    1::816
    1::421     1e-29  35%  423 aa  PF00384 Molybdopterin "Molybdopterin oxidoreductase"
   32::74      2e-06  51%  112 aa  PF01568 Molydop_binding "Molydopterin dinucleotide binding domain"
    1::816

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00384         ----------------------------------------------------------------------
PF01568         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxRLKKPLKRVGERGEGKFQEVDWETALNEIAQRLREIVQRYGPESV
PF00384         -------------------------RLKYPMKRA--RGEGKFVRISWDEALDLIAAKLKEIIKKYGPDAV
PF01568         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AFTRHDHMSWILPFIASVIGTPNIISHEGTCHAASTAVRKFVLGASGPSSVDPDYENANYILLIGRNLDA
PF00384         AATSNESYYLGQKFARALGGLNNIDWYARLCHASA---RTFGGDQTGESTSLEDLENADLIVLWGSN--P
PF01568         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AMGHIRRLTVAREKGXXXXXXDPRAPNLAYSSVEWIPINPGTDAAFVLSLIYVIISEGLYDAAFLKKYTN
PF00384         AETHARFLKEARKRGAKVIVVDPRRTRTAAKADEWLPIRPGTDAALALAMAHVILEEGLYDKDFIADYTD
PF01568         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           APFLIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00384         APVLV-----------------------------------------------------------------
PF01568         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxYTPENAEKITGIPADTIRRIAREFATSRGVAEDGWYTAKNGNDFDAYRAILILNALVGNIDKRGGLC
PF00384         ---YTPERAAEITGVPAEQIRELAREFAAAKAMIIWGMGVTQHTHGTQNIRAIANLALLTGNIGRPGG--
PF01568         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           FQESSKFPSAVTVFQDRIETIIGHVLPPIKAQRLDRLKYPETPATFDALLDAIIEEKPYPVKALFIVATS
PF00384         --GVNPLRGHSNVQGAARDAGLLPVLPPAPQLKSGELKFAEDPDALGNWPGNLFVWRSNAIKALYVLGHN
PF01568         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           PFHRDVNTXXXXXXXXXXXXIVAIDILPQDHIDWSDYVLPDLMFLEREEIGSIKWSLHAGIRYSHKVLDP
PF00384         PLVSHPDANKVEEALAKLDLLVVLDFFMTETALYADIVLPAATWYEKD--GTFTNSERRAQRF-RKAVEP
PF01568         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           PPGVDARSAFWALMEIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00384         PG--EARSDWEILAEL------------------------------------------------------
PF01568         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00384         ----------------------------------------------------------------------
PF01568         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxVWMNPADAERLGIKDGDVVELEGLDNGFKAMAVVKVTNRVKPGVLxxxxxxx
PF00384         ----------------------------------------------------------------------
PF01568         ------------------VEINPEDAAELGIKDGDWVRVSSARGEVEARAV--VTERIRPGVV-------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00384         ----------------------------------------------
PF01568         ----------------------------------------------