[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL64528.1

[Show Plain Result]


## Summary of Sequence Search
    1::106
    1::97      6e-10  40%   97 aa  PF00338 Ribosomal_S10 "Ribosomal protein S10p/S20e"
    1::106

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxVRIRLYGTNPADVEQVAREIVDLAKKMGVQVRGPIPLPTRRLIVTVRRAPSGQGYHTFDHWE
PF00338         --------IRIRLKSFDHRLLDKSAAKIVETAKRTGAKVKGPIPLPTKRKRFTVLRSPHVD-KKSREQFE


                         .         .         *         .         .         .         .:140
query           MRISKRLIDIEASERVLRRLMTIRVPDTVKIELQLx
PF00338         MRTHKRLIDIDPTPKTVDALMRLDLPAGVDVEIKL-