[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL64645.1

[Show Plain Result]


## Summary of Sequence Search
    1::546
   17::156     2e-13  36%  340 aa  PF03600 CitMHS "Citrate transporter"
   85::181     2e-04  25%  434 aa  PF00521 DNA_topoisoIV "DNA gyrase/topoisomerase IV, subunit A"
    1::546

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxRADIIAFVSLMALVLVGVYDLREALSYLISPAVIVLFGSMVISGVIAD
PF03600         ----------------------RVDVVALALLVALLLLGVLTPEEALSGFSNPALILLAGMFVLGAGLER
PF00521         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SGLLDRVARYISVRVRHVATASLLLYFVAGVASGFVSDVAIVLAMAVLIGDVAKRLGASPAAYVIPLAFA
PF03600         TGVFDYIARKLLKRAGGSPLRLLLLLMLTALLSAFLNNTTVVALMIPVVLSLARRLGIPPSLLLIPLSFA
PF00521         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AAIGGRLTMVGNAGNVILLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03600         ANLGGTLTLIGTPTNLVIL---------------------------------------------------
PF00521         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03600         ----------------------------------------------------------------------
PF00521         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPSGPVESLESYVFRPGDEILVLGDEKVIERIAAYYR
PF03600         ----------------------------------------------------------------------
PF00521         ----------------------------------PAAAMRYTEARLSKIARELLADIDKDTVDFVPNYDG


                         .         .         .         .         *         .         .:420
query           LERSKTLVKAFNPRLAASGISGLFAAVVLSQFAPASLAFIIGTFIALLGGGKAVERLYQYVxxxxxxxxx
PF03600         ----------------------------------------------------------------------
PF00521         SEKEPEVLPARFPNLLVNGASGI-AVGMATNIPPHNLGEVIDALIALIDNPEAIEELMEYI---------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03600         ----------------------------------------------------------------------
PF00521         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03600         --------------------------------------------------------
PF00521         --------------------------------------------------------