[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL64909.1

[Show Plain Result]


## Summary of Sequence Search
    1::270
    3::288     6e-31  40%  289 aa  PF02598 DUF171 "Uncharacterized ACR, COG2106"
    1::270

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxSIAIPHDFLSEIPDEAGKVRKLGYLARAAAIFKAEYIIIYHYGTPRREDIDFAKTVLEYLVTPPYLRK
PF02598         --SVAIPGSIISNAQSLELKTYLAGQIARAATIFRVDEIVVFDDSSSERSGAEFLARLLQYLETPPYLRK


                         .         .         *         .         .         .         .:140
query           KVYKIDNRLKLAGLLPPLKIPSHTVPVEPRIGEIREGIVERWDGYYSLIYIGGGKYAKVPKPYPIGTRLL
PF02598         SLFPIHPDLKYAGLLPPLDAPHHLRSDE--WGEYREGVVEKKGGKGTYVNVGLDKPVELNQELPPGTRVT


                         +         .         .         .         .         *         .:210
query           VRIEGTTSRPDTYRAAVYRGAPPDYWGYKIDVRPLQNLSEGFDTVILTGKEGKSICEAKPKIGKKTLVVF
PF02598         VRLKSSST---LFSGKVVSPSEPRYWGY--SVRIASSLSDGYDLTIGTSERGKPVSEVLLELFKHLLIVF


                         .         .         .         +         .         .         .:280
query           GGPRKGVDEIFREAGLEPPGELINFAPGQGVETIRTEEAVFIVLSILxxxxxxxxxxxxx
PF02598         GGLEEGADEEDEKLGVSDPEKLLNTCPGQGSRTIRTEEAVLITLALL-------------