[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL64927.1

[Show Plain Result]


## Summary of Sequence Search
    1::999
    6::217     2e-46  49%  226 aa  PF09985 DUF2223 "Domain of unknown function (DUF2223)"
    3::62      1e-33  35%  349 aa  PF03065 Glyco_hydro_57 "Glycosyl hydrolase family 57"
    1::999

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxIFHNHQPWYLDFSKNELALPWVRMHAVGNYLKVPLLINQSGVSVAFT
PF09985         ----------------------------------------------------------------------
PF03065         -----------------------VLHAHQPYVRHPERGPYEEPWVYLHATETYLPLQVLERLPDFKLTLS


                         .         .         *         .         .         .         .:140
query           LSGSLIEQLNWYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09985         ----------------------------------------------------------------------
PF03065         LSPVLLEQLEDY----------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLLWIDPYIARQNPEIWALRNKTNYTREDLKKVLQIHL
PF09985         ----------------------------------------------------------------------
PF03065         ---------------------------------LLQEDAYLEKLLAEKELLRTEANFYLEDFQRLLEVWE


                         .         .         .         +         .         .         .:280
query           ELIKQVLPVYKKLAEQGRIELVPVPYSHPLMPLLADMGAIYDLKLHVNLSNSLFKRYLGVTPTGVWPPEQ
PF09985         ----------------------------------------------------------------------
PF03065         EYLGDLIPAFRELQDSGQVELLTCPYTHPILPLLND---PEDVRAQIRWGIEDFERRFGRRPKGIWLPEC


                         .         *         .         .         .         .         +:350
query           AVNDEVLRLFANAGYIWTVTDEDVLKATAPGASHFKLYFVQYGDRKLYVFFRDKTLSDNIGFRYSSLSPE
PF09985         ----------------------------------------------------------------------
PF03065         AYSPGLLEILAEAGIRYFILDGHGLLLGAPPSPEY--LYRPYSGSGVAVFFRDHELSDQVWFSYSGYPGD


                         .         .         .         .         *         .         .:420
query           AALADFVNYLKRVPREKCSVVVIALDGENPWENYPNFGDDFLRVFFQGLAQLEKNGTVKIWKPSDFIKAC
PF09985         ----------------------------------------------------------------------
PF03065         PAYREFYRYLAWASYDPPQVVVIALDGENFWGHYPGEGKGFLEALYRLLAELHARGFIRLVTPSEYLE--


                         .         .         +         .         .         .         .:490
query           GNEAAELPQREFKYFDLHLDLSFYKSIRDLPTRLVNGRIAEGSWSGGGSLAVWIGDxxxxxxxxxxxxxx
PF09985         ----------------------------------------------------------------------
PF03065         ------------KY----------------PPRGIVVLPYDGSW-GEGDFSTWIGD--------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09985         ----------------------------------------------------------------------
PF03065         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09985         ----------------------------------------------------------------------
PF03065         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDPVGDD
PF09985         ----------------------------------------------------------------DPEGDD
PF03065         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           FGPGRYQYPKNPVFKPGVFDLTEFSLYDVGDKLRFVFKVRELGDNPWGGPAGFSLQFFHVYINRGSGSRN
PF09985         HGPGTYTYPTDPVFKPGVFDLTKFEVLEDGDNLVFEFTFKNL-TNPWNGPNGFSLQTIQIYIDTKEGGAT
PF03065         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           DTLGLRVALCRDAAWDVALLIGPGWSGGNRIVYSDNTYVDDAMSIKVAPNNTVVADVPKRYIGEFNSSWK
PF09985         SALGLNVSLDPEHPWDVAIVI-TGWSYGNAIYDADGTVVSPAPQVSADPSNTIIVRVPKKYLGDTEPGWK
PF03065         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           ITVFLTSWDGYGPDNIRNFGVVSDEWTAGGADPVAVLANVAPRVFDLLAETAEQQIKALTSYxxxxxxxx
PF09985         YYVLVGSQDGYGPDRIRPVAPEAGQWRFGGGDPSA-LAGVAPRVIDVLVPEGPTQEEMLSSY--------
PF03065         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09985         ----------------------------------------------------------------------
PF03065         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxx
PF09985         -------------------
PF03065         -------------------