[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL64945.1

[Show Plain Result]


## Summary of Sequence Search
    1::181
    6::173     8e-13  39%  178 aa  PF01558 POR "Pyruvate ferredoxin/flavodoxin oxidoreductase"
    1::181

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxLTLARWIGEAALAEGYDVRIAEVHGMSQRGGSVEVHVRYGKDIYAPIVEEGGADY
PF01558         ---------------VTAGKILAKAAAREGKYVQTYPVYGSEQRGGVVRSHVRISKPIIAPY-PVGEADV


                         .         .         *         .         .         .         .:140
query           VIALEALEALRAYKYLKRGGELIVNRRVIQPPGNWLEEEEVFKAILTSGLKSYIVPCFDIAIELGSPLYE
PF01558         LIALDP----KALKYLKPGGTIIVNSPGVPPEDLEKKLPAAFRAIAEKGIRVYVIDATKIAKELGGGRVA


                         +         .         .         .         .         *         .:210
query           NAVMLGFFSQLAGLPMPPSLDERNREAFRRGALVYNSLAPY
PF01558         NMVMLGALFALTGLPL-EALEEAIEEKFKKGEVVEANLKAF