[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL64946.1

[Show Plain Result]


## Summary of Sequence Search
    1::390
   20::84      9e-06  43%  139 aa  PF02775 TPP_enzyme_C "Thiamine pyrophosphate enzyme, C-terminal TPP
    1::390

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02775         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02775         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMGSSVGLGAGIALATGQFVVATVG
PF02775         ----------------------------------------------MGYGLPAALGAALANDRRVVAVIG


                         .         .         .         +         .         .         .:280
query           DSTFYHAVLPQLVDIATRSVPILIVVMDNAYTAMTGGQPSPxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02775         DGAFGMSL--QELNTAVRGLPIIIVVLNNEGYGMTGGQQTP-----------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02775         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02775         ----------------------------------------