[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL64972.1

[Show Plain Result]


## Summary of Sequence Search
    1::251
    4::141     3e-13  37%  141 aa  PF00239 Resolvase "Resolvase, N terminal domain"
    1::251

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxYIRVSTEEQDPENQRVFLERWAGERGIYIVKHYVDVGVSGATEPWERPAFRQMASEVDKLEPRP
PF00239         ------YARVSTDDQDLERQREALEEYAKENGWEIVEIYED-KISGT--KFDRPGLQRLLADLREGD---


                         .         .         *         .         .         .         .:140
query           RVLLVYEISRLVRSFQELFTLLDVVENRLGLVVVSASEREQALQNLDGVYRQFLRAVLAFVATMEREFIR
PF00239         -VLVVESLDRLGRNLRDLLELLEELRKK-GVRIVSLDEGIDTLTPMG----RLLLDILAALAEFERELIS


                         +         .         .         .         .         *         .:210
query           QRTKTALERARLQGKVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00239         ERTKEGIAAAKARGKL------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00239         -----------------------------------------