[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL65054.1

[Show Plain Result]


## Summary of Sequence Search
    1::346
    2::58      1e-08  46%   58 aa  PF06858 NOG1 "Nucleolar GTP-binding protein 1 (NOG1)"
    2::169     2e-08  31%  188 aa  PF02421 FeoB_N "Ferrous iron transport protein B"
    1::105     1e-05  31%  105 aa  PF01926 MMR_HSR1 "GTPase of unknown function"
    1::346

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06858         ----------------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06858         ----------------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxTIVVAGAPNVGKSSFVRCVSTAKPEVAEYPFTTKQIHLGHI
PF06858         ----------------------------------------------------------------------
PF02421         -----------------------------TIALVGNPNVGKTTLFNALTGARQHVGNWPGVTVEKKEGKF
PF01926         ---------------------------------------GKSTLFNALTRARAKVANYPGTTRDPNVGVV


                         .         .         .         +         .         .         .:280
query           FLRGDRVQVIDTPGLLDRPLSERNQIEKQAILALRHLAGVIVFVVDPTPHSGYSLEMQERLWREIKEGFS
PF06858         -------------------------IEMQAITALAHLRAAVLYVMDLSEQCGYSIEEQLELFESIKPLFN
PF02421         KLGGKQVTLVDLPGTYSSPYSLDEQVARDYLLEEK--PDVIINVVDAT-----NLERNLYLTLQLLE-LG
PF01926         EVKGTQIELVDTPGLIKGASKGEGELGNKFLRHIRE-ADAILHVVDAEPDNENDLEIIDLL--RLKK---


                         .         *         .         .         .         .         +:350
query           APAVAVLNKIDIATEEELEKARAIFAPIGEISTLNCRGTKEVMDYVLQKYYVPAALxxxxxxxxxx
PF06858         KPWIVVINKID-------------------------------------------------------
PF02421         IPVVVALNMMDEAEKRDIKKSKLLGVPVVPTSARKGEGLKEAIDELAEKKKKPKPL----------
PF01926         --VIVVLNK---------------------------------------------------------