[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL65065.1

[Show Plain Result]


## Summary of Sequence Search
    1::306
   29::296     7e-41  44%  297 aa  PF06626 DUF1152 "Protein of unknown function (DUF1152)"
    1::306

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxVGQIPWERYXXXXXXXXXXXXSLREVLDLGNGLYLATPRSFAERGG
PF06626         ------------------------LGAVVWERYVVDPLPGPIPPDELRGAELVGEGLYIVNPRSYAIRGG


                         .         .         *         .         .         .         .:140
query           RLFKTQGMCVAEALQKSVYLVDPYRRPSELAKALVRFDKIIXXXXXXXXXXXXCEESLRSPLADAYGLAV
PF06626         RRVVPQLVRAARALGKSVYLIDPKTGVKGLAEALLGIDAIVGVDGGGDVLARGDEEGLGSPLADSISLAA


                         +         .         .         .         .         *         .:210
query           LAKASELGVEAELWVMSPGADGELSLEYLIRRVAEAAREGGLLGTVGLDSKQVEVLEKLVKRCVTEASAV
PF06626         LNKLEEE--EVLLAVIGFGVDGELSHEYLLERIAELAREGGLLGAFGLTREMAEVLEAVLERVPTEASIV


                         .         .         .         +         .         .         .:280
query           AVRAFKGEYGPAHIRGGARLVEIGACALIGFKFSPXXXXXXXXXXRLIYESDAPIDKAADLLIENGIPTE
PF06626         PLAAFRGEYGEVHIRTGGREVFVNPLMAIYFFFDPEKVAERSLLAELVKDTES-IEEANERLNELGIYTE


                         .         *         .         .         .         .         +:350
query           LHLEQLLAKxxxxxxxxxxxxxxxxx
PF06626         LDLERDLAR-----------------