[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL65069.1

[Show Plain Result]


## Summary of Sequence Search
    1::315
  128::341     8e-06  31%  341 aa  PF00155 Aminotran_1_2 "Aminotransferase class I and II"
    1::315

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00155         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVLIFSNPNNPTGRYLEKRELAELADEARRK
PF00155         ----------------------------------------LIVLPNPNNPTGAVLSLEELEELAELARKY


                         +         .         .         .         .         *         .:210
query           GAYLIIDIIFSDFVTDDLRGFPLENVAYSHSTDKFYTHDLRAGWVFGDEEIVRRVKYLKDLANPGPXXXX
PF00155         DLLIIEDEAYEDFVSASLDGDP--NVIVLGSFSKFGLPGLRLGYIVAPPELIEALRKLRPLTSPSTPLQA


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXVKRRNLSIIKPNATALLTRFPNALYKPHMPIALIPTGCNDAKLAERLLAMGVKTVPG
PF00155         AAAAALSDGGLLD---RHLEELRARLRERRDLLREALEELGLEV-IPPEGLDAEELAQALLEEGVLVVPG


                         .         *         .         .         .         .         +:350
query           RLFQAPYSIRVGLGVEEPPRFREALEILxxxxxxx
PF00155         SGFPGPGYLRISFALTE-EELEEALELL-------