[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for paer1:AAL65085.1

[Show Plain Result]


## Summary of Sequence Search
    1::364
    2::164     1e-05  27%  164 aa  PF04055 Radical_SAM "Radical SAM superfamily"
    1::364

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04055         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxISTWGCNFPCAWCQNWHLSKTASPAGAYVPPERVVEWALE
PF04055         ------------------------------VVTRGCNLRCTFCDNPETELRGFGRSLSVEEEELEELGAE


                         +         .         .         .         .         *         .:210
query           NGDSGVNVSFNEPTLLAEYAEEVFRLARARGLHASINTNGYLTEEAVRRLAEAGMEGMNIDIKGGRETYR
PF04055         LGVKEVILGGGEPLLYPDFVELLLRLAKEPGIRITLETNGTLPDELLDELAELGLDRLAIGLQSLDDEVL


                         .         .         .         +         .         .         .:280
query           RWLAANFDKFLSTARHAKGMGIHVEFTYLVIPGVNDHEAEEVIEAxxxxxxxxxxxxxxxxxxxxxxxxx
PF04055         KAIGHTLEEILEAIELLREAGFKV-VTHLIVPGETDEDEELLLLA-------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04055         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxx
PF04055         --------------