[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL62507.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1atgA.bssp"
#ERROR : Can't open dsspfile "2v3qA1.bssp"
#ERROR : Can't open dsspfile "1a40A.bssp"
#ERROR : Can't open dsspfile "1i69A.bssp"
#ERROR : Can't open dsspfile "1potA.bssp"
#ERROR : Can't open dsspfile "1j1nA.bssp"
#ERROR : Can't open dsspfile "1o63A.bssp"

## Summary of PDB Search
:313
    5e-11  15%  1atgA  [c.94.1.1] PERIPLASMIC MOLYBDATE-BINDING PROTEIN
    1e-07  11%  2v3qA1 [c.94.1.1] HUMAN PHOSPHATE BINDING PROTEIN A:1 -- 376
    1e-06  22%  1a40A  [c.94.1.1] PHOSPHATE-BINDING PERIPLASMIC PROTEIN PRECURSOR
    2e-05  18%  1i69A  [c.94.1.1] HYDROGEN PEROXIDE-INDUCIBLE GENES ACTIVATOR
    1e-04  11%  1potA  [c.94.1.1] SPERMIDINE/PUTRESCINE-BINDING PROTEIN
    3e-04  13%  1j1nA  [c.94.1.1] ALGQ2
    6e-04  11%  1o63A  [c.94.1.1] ATP PHOSPHORIBOSYLTRANSFERASE
:313

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxASTSTTTPQKIVLYMATTTSVKDTGLLDVLIPD
1atgA           ----------------------------------------------ELKVVTATNF----LGTLEQLAGQ
2v3qA1          --------------------------------------------------------------LYLTPDVL
1a40A           ------------------------------------------------------------------PAPV
1i69A           ----------------------------------------------------------------------
1potA           --------------------------------------------------------------VPPGLLEQ
1j1nA           -------------------------------------ATWVTDKPLTLKIHMHFRDKWVW-DENWPVAKE
1o63A           ---------------------------------------------PKGRLEEKVXT------YLKKTGVI


                         .         .         *         .         .         .         .:140
query           FEKWAASRGYNIEVRYTAVGTGQALAMAARGDVDVVIVHAPSLEKQYLENGTLKCRDVIAYNFFIIVGPR
1atgA           FAK-----QTGHAVVISSGSSGPVYAQIVNGPYNVFFSADEKSPEKLDNQGFALPGSTYAIGKLVLWSAK
2v3qA1          TAGFAIGVGSGKGKIAFLENKYNQFGTDTTKNVHWAGSDSKLTATELATYAADKEPGWSVATSVAIPFRK
1a40A           YAKWADQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAP-LSDEKLAQEGLFQFPTVIGGVVLAVNIP
1i69A           ----------KLEMYLHEAQTHQLLAQLDSGKLDAVILALVK------ESEAFIEVPLFDEPMLLAIYED
1potA           FTK-----ETGIKVIYSTYESNYAKLKTYKDGAYDLVVPSTYYVDKMRKEGMIQKIDKSKLTDPDMLNKP
1j1nA           SFR-----LTNVKLQSVANKAATNSMMASGDLPDVVGGDNLKDKIQYGQEGAFVPLNKLIDQYAPHIKAF
1o63A           FERESSILREGKDIVCFXVRPFDVPTYLVHGVADIGFCGTDVLLEKETSLIQPFFIPTNISRXVLAG-PK


                         +         .         .         .         .         *         .:210
query           DDPAGAKSLTATEAFRRIAEAKAPFVSRGDRSGTHLMELSLWRRAIGREPDPKNDTWYISAGAGMGQTLL
1atgA           PGLVDNQKVLAGNGWRHIAISNPQIAPYGLAGTQVLTHLGLLDKLT----AQERIVEANSVGQAHS---Q
2v3qA1          AGAFSGRIADWSGITGAGRSGPIQVVYRAESSGTTLFTRFLNAKCTGTFAVTTTFANSYSLGLTPLAGAV
1a40A           GLKSGELVLD-GKTLGDIYLGKIKVVRRADGSGTYLAKVNEWKNNVGTGSTVKWPIGLGGKGNDG-----
1i69A           HPWANREAVPMADL------AGEKLLMLEDGHSLR-------DQAMGFCFDTHFRATSLETAAGSGITLL
1potA           FDPNNDYSIPYIWGATAIGVNGDAVDPKSVTSWADLWKPEYKGSLLLTDDTTDPKEINVAAFNSDNPANP
1j1nA           FKSHPEVERAIK----------------------------------------------------------
1o63A           GRGIPEGEKRIATKFPNVTQ--------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LANEKSAYTLSDTGTWLRYRDKLPQLDVIVQAAPDLINIYSFSIVKLSNATRLMAQYMKTRxxxxxxxxx
1atgA           TASGAADLGFVALAQIIQAAAKIPGSHWFPPANYYEPIVQQAVITKSTAEKANAEQFMS-----------
2v3qA1          AAT-------------------------------------------------------------------
1a40A           ----------------------------------------------------------------------
1i69A           PALAVPPERKRDGVVYLPAIKPEPRRTIGLVYRPGSP---------LRSRYEQLAEAIRAR---------
1potA           YMEGEVNLGMIWNGSAFVARQAGTPIDVVWPKEGGIFWMDSLAIPANAKNKEGALKLIN-----------
1j1nA           ----------------------------------------------------------------------
1o63A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1atgA           ---------------------------------
2v3qA1          ---------------------------------
1a40A           ---------------------------------
1i69A           ---------------------------------
1potA           ---------------------------------
1j1nA           ---------------------------------
1o63A           ---------------------------------