[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL62792.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bo4A1.bssp"
#ERROR : Can't open dsspfile "1omxA.bssp"
#ERROR : Can't open dsspfile "1h7lA.bssp"
#ERROR : Can't open dsspfile "1xhbA2.bssp"
#ERROR : Can't open dsspfile "2dm9A1.bssp"

## Summary of PDB Search
:394
    1e-20  19%  2bo4A1 [c.68.1.18] MANNOSYLGLYCERATE SYNTHASE A:2 -- 382
    5e-19  16%  1omxA  [c.68.1.15] ALPHA-1,4-N-ACETYLHEXOSAMINYLTRANSFERASE EXTL2
    7e-16  15%  1h7lA  [c.68.1.1] SPORE COAT POLYSACCHARIDE BIOSYNTHESIS PROTEIN
    3e-13  19%  1xhbA2 [c.68.1.17] POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 1
    8e-13   8%  2dm9A1 [d.81.4.1] V-TYPE ATP SYNTHASE SUBUNIT E A:81 -- 198
:394

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxITVVLPTLNEAQALPKVVEELRATGYRDILVVDGGSTDGTVEEAKRLGLRVIGQYGRGKGMALRTALM
2bo4A1          ----VVFPFKHEHPEVLLHNVRVAAAHPRHEVLCIGYERDQTYEAVERAAGTLRPGKGDGMNTALRYFLE
1omxA           --FTLIMQTYNRTDLLLRLLNHYQAVPSLHVIVVWNNVKGPEELWNSLGPHPIFKPQTANKMRNRLQVFP
1h7lA           --VSVIMTSYNKSDYVAKSISSILSQTFSDLFIMDDNSNEETLNVIRPFLNDKERTEKTRYAALINQAIE
1xhbA2          --TSVVIVFHNEAWSTLLRTVHSINRSPRHIVLVDDASERDFLKRPLESYVKIRMEQRSGLIRARLKGAA
2dm9A1          -------------------ISSVLEEVKRRTMSEDEYFESVKALLKEAIKELMSNEKTLGLIASRIEEIK


                         .         .         *         .         .         .         .:140
query           YVETPYVAVLDADYTYPPAELNKLVPLLRHYDVVIGARQGKMPALYKLGNKVLAWLFRVLFGVDLRDPLT
2bo4A1          ETQWERIHFYDADITSFPDWITKAEEAADGYGLVRHYFPTDAMITWMITRTGFALLWPHTELSWIEQPLG
1omxA           EVETNAVLMVDDDTLISAQDLVFAFIWQQFPDQIIGFVPRKHSSGIYSYGGFELQTPGPGNGDQYSMVLI
1h7lA           MAEGEYITYATDDNIYMPDRLLKMVELDTHPEKAVIYSASKTYHLNDIVKETVRPAAQVTWNAPC--AID
1xhbA2          VSRGQVITFLDAHCECTAGWLEPLLARIKHDTVVCPII--------------------------------
2dm9A1          SELGDVSIELGETVDTMGGVIVETEDGRIRIDNTFEARME--RFEGEIRSTIAKVLF-------------


                         +         .         .         .         .         *         .:210
query           GMYVARTDVLREAVTEARGFDLEVEILAKALANGARVAEVPIQYRERIGKKKLRPWHxxxxxxxxxxxxx
2bo4A1          GELLMRREVAAMRVRRRSDWGIDTLYTFVTVQQGVSIYECYIPEGKAHRLYGGLDDL-------------
1omxA           G---------------------------------------------------------------------
1h7lA           HCSVMRYSVLEKVKEKFGSYDARFFWRVNHFYPFYPLDEELDLNYIT-----------------------
1xhbA2          ----------------------------------------------------------------------
2dm9A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bo4A1          ----------------------------------------------------------------------
1omxA           ----------------------------------------------------------------------
1h7lA           ----------------------------------------------------------------------
1xhbA2          ----------------------------------------------------------------------
2dm9A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bo4A1          ----------------------------------------------------------------------
1omxA           ----------------------------------------------------------------------
1h7lA           ----------------------------------------------------------------------
1xhbA2          ----------------------------------------------------------------------
2dm9A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bo4A1          --------------------------------------------
1omxA           --------------------------------------------
1h7lA           --------------------------------------------
1xhbA2          --------------------------------------------
2dm9A1          --------------------------------------------