[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL62997.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ixkA.bssp"
#ERROR : Can't open dsspfile "2b9eA1.bssp"
#ERROR : Can't open dsspfile "2ar0A1.bssp"
#ERROR : Can't open dsspfile "1sqfA2.bssp"
#ERROR : Can't open dsspfile "1sqwA1.bssp"
#ERROR : Can't open dsspfile "1wxwA2.bssp"
#ERROR : Can't open dsspfile "1iq8A3.bssp"
#ERROR : Can't open dsspfile "2apoA1.bssp"
#ERROR : Can't open dsspfile "1r3eA1.bssp"
#ERROR : Can't open dsspfile "1q7hA1.bssp"
#ERROR : Can't open dsspfile "1im8A.bssp"
#ERROR : Can't open dsspfile "1yzhA1.bssp"
#ERROR : Can't open dsspfile "1pgjA2.bssp"
#ERROR : Can't open dsspfile "2i6gA1.bssp"
#ERROR : Can't open dsspfile "1zs7A1.bssp"
#ERROR : Can't open dsspfile "1aqiA1.bssp"
#ERROR : Can't open dsspfile "1uirA.bssp"
#ERROR : Can't open dsspfile "2h00A1.bssp"
#ERROR : Can't open dsspfile "2b78A1.bssp"
#ERROR : Can't open dsspfile "1f38A.bssp"
#ERROR : Can't open dsspfile "1dctA.bssp"
#ERROR : Can't open dsspfile "1xdzA.bssp"
#ERROR : Can't open dsspfile "1eg2A.bssp"
#ERROR : Can't open dsspfile "1ahhA.bssp"
#ERROR : Can't open dsspfile "1pjzA.bssp"
#ERROR : Can't open dsspfile "1ws6A1.bssp"
#ERROR : Can't open dsspfile "1kp9A.bssp"
#ERROR : Can't open dsspfile "1rylA.bssp"
#ERROR : Can't open dsspfile "1o89A2.bssp"
#ERROR : Can't open dsspfile "1zbqA1.bssp"
#ERROR : Can't open dsspfile "2o57A1.bssp"
#ERROR : Can't open dsspfile "2esrA1.bssp"
#ERROR : Can't open dsspfile "2q07A1.bssp"
#ERROR : Can't open dsspfile "1piwA2.bssp"
#ERROR : Can't open dsspfile "2bzgA1.bssp"
#ERROR : Can't open dsspfile "1ixkA.bssp"
#ERROR : Can't open dsspfile "2b9eA1.bssp"

## Summary of PDB Search
:379
    1e-38  32%  1ixkA  [c.66.1.38] METHYLTRANSFERASE
    2e-37  27%  2b9eA1 [c.66.1.38] NOL1/NOP2/SUN DOMAIN FAMILY, MEMBER 5 ISOFORM 2
    9e-15   9%  2ar0A1 [c.66.1.45] TYPE I RESTRICTION ENZYME ECOKI M PROTEIN A:6 --
    6e-13  23%  1sqfA2 [c.66.1.38] SUN PROTEIN A:145 -- 429
    2e-10  15%  1sqwA1 [b.122.1.1] SACCHAROMYCES CEREVISIAE NIP7P HOMOLOG A:95 --
    2e-10  20%  1wxwA2 [c.66.1.51] HYPOTHETICAL PROTEIN TTHA1280 A:65 -- 382
    4e-10  29%  1iq8A3 [b.122.1.1] ARCHAEOSINE TRNA-GUANINE TRANSGLYCOSYLASE A:506
    6e-10  30%  2apoA1 [b.122.1.1] PROBABLE TRNA PSEUDOURIDINE SYNTHASE B A:247 --
    1e-09  19%  1r3eA1 [b.122.1.1] TRNA PSEUDOURIDINE SYNTHASE B A:238 -- 318
    4e-09  28%  1q7hA1 [b.122.1.1] CONSERVED HYPOTHETICAL PROTEIN A:69 -- 153
    2e-07  29%  1im8A  [c.66.1.14] YECO
    2e-06  12%  1yzhA1 [c.66.1.53] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE A:8 --
    3e-06  17%  1pgjA2 [c.2.1.6] 6-PHOSPHOGLUCONATE DEHYDROGENASE A:1 -- 178
    3e-06  28%  2i6gA1 [c.66.1.44] PUTATIVE METHYLTRANSFERASE A:1 -- 198
    3e-06  30%  1zs7A1 [b.122.1.1] HYPOTHETICAL PROTEIN APE0525 A:91 -- 186
    5e-06  11%  1aqiA1 [c.66.1.27] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI A:21 --
    6e-06  11%  1uirA  [c.66.1.17] POLYAMINE AMINOPROPYLTRANSFERASE
    8e-06  11%  2h00A1 [c.66.1.54] METHYLTRANSFERASE 10 DOMAIN CONTAINING PROTEIN
    8e-06  10%  2b78A1 [b.122.1.9] HYPOTHETICAL PROTEIN SMU.776 A:1 -- 68
    1e-05  28%  1f38A  [c.66.1.22] PRECORRIN-8W DECARBOXYLASE
    1e-05  15%  1dctA  [c.66.1.26] PROTEIN (MODIFICATION METHYLASE HAEIII)
    3e-05  12%  1xdzA  [c.66.1.20] METHYLTRANSFERASE GIDB
    5e-05  17%  1eg2A  [c.66.1.11] MODIFICATION METHYLASE RSRI
    1e-04  17%  1ahhA  [c.2.1.2] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-04  10%  1pjzA  [c.66.1.36] THIOPURINE S-METHYLTRANSFERASE
    2e-04  18%  1ws6A1 [c.66.1.46] METHYLTRANSFERASE A:15 -- 185
    2e-04  14%  1kp9A  [c.66.1.18] CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE 1
    3e-04  12%  1rylA  [d.276.1.1] HYPOTHETICAL PROTEIN YFBM
    3e-04  25%  1o89A2 [c.2.1.1] YHDH A:116 -- 292
    3e-04  17%  1zbqA1 [c.2.1.2] 17-BETA-HYDROXYSTEROID DEHYDROGENASE 4 A:3 -- 304
    5e-04  18%  2o57A1 [c.66.1.18] PUTATIVE SARCOSINE DIMETHYLGLYCINE A:16 -- 297
    7e-04  16%  2esrA1 [c.66.1.46] METHYLTRANSFERASE A:28 -- 179
    7e-04  25%  2q07A1 [b.122.1.1] UNCHARACTERIZED PROTEIN AF0587 A:460 -- 527
    7e-04  36%  1piwA2 [c.2.1.1] HYPOTHETICAL ZINC-TYPE ALCOHOL DEHYDROGENASE-
    7e-04   7%  2bzgA1 [c.66.1.36] THIOPURINE S-METHYLTRANSFERASE A:17 -- 245
    1e-10  33%  1ixkA  [c.66.1.38] METHYLTRANSFERASE(query 10->85)
    6e-06  26%  2b9eA1 [c.66.1.38] NOL1/NOP2/SUN DOMAIN FAMILY, MEMBER 5 ISOFORM 2(query 40->82)
:379

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxDLLYKHFLEFLSDAEIDSLFRSITTPPPRYYIRVNTLKISPRELVKRLNSRGLAVYRDEYI
1ixkA           ----------------------------------------------------------------------
2b9eA1          ----------------------------------------------------------------------
2ar0A1          ----------------------------------------------------------------------
1sqfA2          ----------------------------------------------------------------------
1sqwA1          ----------------------------------------------------------------------
1wxwA2          ----------------------------------------------------------------------
1iq8A3          ----------------------------------------------------------------------
2apoA1          ----------------------------------------------------------------------
1r3eA1          ----------------------------------------------------------------------
1q7hA1          ----------------------------------------------------------------------
1im8A           ----------------------------------------------------------------------
1yzhA1          ----------------------------------------------------------------------
1pgjA2          ----------------------------------------------------------------------
2i6gA1          ----------------------------------------------------------------------
1zs7A1          ----------------------------------------------------------------------
1aqiA1          ----------------------------------------------------------------------
1uirA           ----------------------------------------------------------------------
2h00A1          ----------------------------------------------------------------------
2b78A1          ----------------------------------------------------------------------
1f38A           ----------------------------------------------------------------------
1dctA           ----------------------------------------------------------------------
1xdzA           ----------------------------------------------------------------------
1eg2A           ----------------------------------------------------------------------
1ahhA           ----------------------------------------------------------------------
1pjzA           ----------------------------------------------------------------------
1ws6A1          ----------------------------------------------------------------------
1kp9A           ----------------------------------------------------------------------
1rylA           ----------------------------------------------------------------------
1o89A2          ----------------------------------------------------------------------
1zbqA1          ----------------------------------------------------------------------
2o57A1          ----------------------------------------------------------------------
2esrA1          ----------------------------------------------------------------------
2q07A1          ----------------------------------------------------------------------
1piwA2          ----------------------------------------------------------------------
2bzgA1          ----------------------------------------------------------------------
1ixkA           ---------KLFADRYFQLWGERAIR-IAEAXEKPLPRC-FRVNTLKISVQDLVKRLNKKGFQFKRVPWA
2b9eA1          ---------------------------------------FVRVNTLKTCSDDVVDYFKRQGFSYQGRASS


                         .         .         *         .         .         .         .:140
query           DDALWVPVEGPFKIPxxxxxxxxxxxxxESVMLGADLYAPAVIKTDRVNIGDEVNIVSDNGRVVALGVAV
1ixkA           ----------------------------------------------------------------------
2b9eA1          ------------------------------------------LKTCSDDVVDYFK---RQGFSYQGRASS
2ar0A1          ----------------------------------------------------------------------
1sqfA2          ----------------------------------------------------------------------
1sqwA1          ----------------------------QSFLYGNHVLKSGLGRTENTSQYQGVVVYSMADIPLGFGVAA
1wxwA2          ----------------------------------------------------------------------
1iq8A3          ----------------------------PFARKGKDVFAKFVIFDPGIRPYDEVLVVNENDELLATGQAL
2apoA1          ----------------------------DAICHGADVYVRGIAKSKGIGKGETVLVETLKGEAVAVGKAL
1r3eA1          ----------------------------KMILNGSQIHLEMLKEWDGFKKGEVVRVFNEEGRLLALAEAE
1q7hA1          ----------------------------PHILNGSDLFAPGIVSDDSIRKGDXIFVKSSKGYFIAVGXAE
1im8A           ----------------------------------------------------------------------
1yzhA1          ----------------------------------------------------------------------
1pgjA2          ----------------------------------------------------------------------
2i6gA1          ----------------------------------------------------------------------
1zs7A1          ----------------------------IALAKGAHLXIPGVVGEGSFTRGDVVAALYETRTPVXVGVAE
1aqiA1          ----------------------------------------------------------------------
1uirA           ----------------------------------------------------------------------
2h00A1          ----------------------------------------------------------------------
2b78A1          ----------------------------KKLKRGVQLLSSRDYPNL-NLDNQVVQLYSDADIFLGTAYLS
1f38A           ----------------------------------------------------------------------
1dctA           ----------------------------------------------------------------------
1xdzA           ----------------------------------------------------------------------
1eg2A           ----------------------------------------------------------------------
1ahhA           ----------------------------------------------------------------------
1pjzA           ----------------------------------------------------------------------
1ws6A1          ----------------------------------------------------------------------
1kp9A           ----------------------------------------------------------------------
1rylA           ---------------------------------KNDPLSRAVLGEHLEDDGFLGLTWNQELAATIDRLES
1o89A2          ----------------------------------------------------------------------
1zbqA1          ----------------------------------------------------------------------
2o57A1          ----------------------------------------------------------------------
2esrA1          ----------------------------------------------------------------------
2q07A1          ----------------------------GDFEVKGTIFAGGVLRADKIRPNDVVVFH--NSRIFGVGLAA
1piwA2          ----------------------------------------------------------------------
2bzgA1          ----------------------------------------------------------------------
1ixkA           KEGFCL-TREPFSIT-------------------------------------------------------
2b9eA1          LDDLRALKGKHF----------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           MDSDEALKARRGLYIKVEKSLYRTPKLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGK
1ixkA           ---KKGFQFKRVPWAKEGFCLTREPSITSTPEFLTGLIYIQEASSXYPPV-ALDPKPGEIVDXAAAPGGK
2b9eA1          LDDLRALKGKHFLLDPLMPELLVFPALHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNK
2ar0A1          --------------------PKQITALVSNXDSLDWQYFTPRPLIKTIIHLLKPQPREVVQDPAAGTAGF
1sqfA2          --------------------LETPAPVHALPGFEDGWVTVQDASAQGCMTWLAPQNGEHILDLCAAPGGK
1sqwA1          KSTQDCRKVDPMAIVVFHQA--------------------------------------------------
1wxwA2          ------------------------------------------------------------LDVFSYAGGF
1iq8A3          LSGREMIVFQYGRAVKVRKGV-------------------------------------------------
2apoA1          MNTKEILNADKGVAVDVERVY-------------------------------------------------
1r3eA1          RNSSFLETLRKERVLTLRKVF-------------------------------------------------
1q7hA1          XDAGEVXATKRGKAARII----------------------------------------------------
1im8A           -------------------------------------GYSNIITAI--GXLAERFVTADSYDLGCSRGAA
1yzhA1          -------------------------------EANPQYVVLNPLEAKAKWRDLFGNDNPIHVEVGSGKGAF
1pgjA2          ----------------------------------------------------------------------
2i6gA1          ---------------------------------------------------AXVVAPGRTLDLGCGNGRN
1zs7A1          VDSSALEKLYR-----------------------------------------------------------
1aqiA1          ------------------------------------------------------------LEPACAHGPF
1uirA           ------------------------------------------------------------LIVGGGEGAT
2h00A1          ------------------------------PTVPLRLNYIHWVEDLIGHQDSDKSTLRRGIDIGTGASCI
2b78A1          KQNKGVGWL-------------------------------------------------------------
1f38A           ----------------------------------------------LIXCLAEPGKNDVAVDVGCGTGGV
1dctA           ------------------------------------------------------------ISLFSGAGGL
1xdzA           ------------------------------ITEKKEVYLKHFYDSITAAFYVDFNQVNTICDVGAGAGFP
1eg2A           -------------------------------------------------------------DFFAGSGVT
1ahhA           ----------------------------------------------------------------------
1pjzA           ------------------------------------------------------------LVPLCGKSQD
1ws6A1          ------------------------------------------------------------LDPFAGSGAV
1kp9A           ------------------------------------------------------------LDVGCGWGAT
1rylA           LDRNELRKQFSIKRLNEMEIY-------------------------------------------------
1o89A2          --------------------------------------------------------DGEIVVTGASGGVG
1zbqA1          --------------------------------------------------------------------GA
2o57A1          ------------------------------------------------------------LDLGAGYGGA
2esrA1          --------------------------------------------------IGPYFNGGRVLDLFAGSGGL
2q07A1          XSGKE--XAGSGIAINVKR---------------------------------------------------
1piwA2          ----------------------------------------------------------------------
2bzgA1          ------------------------------------------------------------FFPLCGKAVE
1ixkA           ----------------------------------------------------------------------
2b9eA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TTHLAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDRDFPKIKAGVALVDPPCTDIGV
1ixkA           TSYLAQLDGVIYAFDVDENRLRETRLNLSRLGV---LNVILFHSSSLHIGELNVEFDKILLDAPCTGSGT
2b9eA1          TSHLAALQGKIFAFDLDAKRLASMATLLARAGVSC-CELAEEDFLAVSPSDPRYEVHYILLDPSCSGVRL
2ar0A1          LIEADRYHRAFIGLELVPGTRRLALXNCLLHDIEGNLDHGGAIRLGNSDGENLPKAHIVATNPPFGSAAG
1sqfA2          TTHILEVEAQVVAVDIDEQRLSRVYDNLKRLGMKATVKQGDGRYPSQ--WCGEQQFDRILLDAPCSATGV
1sqwA1          ----------------------------------------------------------------------
1wxwA2          ALHLALGFREVVAVDSSAEALRRAEENARLNGLGNVRVLEANAFDLLRRLEKEGERFDLVVLDPPAFA--
1iq8A3          ----------------------------------------------------------------------
2apoA1          ----------------------------------------------------------------------
1r3eA1          ----------------------------------------------------------------------
1q7hA1          ----------------------------------------------------------------------
1im8A           TRNINQPNVKIIGIDNSQPXVERCRQHIAAYHSEIPVEILCNDIRHVE----------------------
1yzhA1          VSGXAKQDINYIGIDIQKSVLSYALDKVLEVGVPNIKLLWVDG---SDLTDYFEDGEIDRLYLNFSD---
1pgjA2          --NIAEKGFKVAVFNRTYSKSEEFMKANASAPFAGNLKAFETMEAFAASLKKPRKALILVQAGAATDLVD
2i6gA1          SLYLAANGYDVTAWDXNPASXANLERIXAAEGLD-NLQTDLVDLNTLTFD--------------------
1zs7A1          ----------------------------------------------------------------------
1aqiA1          LRAFRETGYRFVGVEIDPKALDLPPWAEGILADFLWEPGEAFDLILGNPPYGIVKAVKDLYKKAFSTWKG
1uirA           LREVLKHVEKAVMVDIDGELVEVAKRHMPEWHQGAFDDPRAVLVIDDARAYLERTEERYDVVIIDLTDPV
2h00A1          YPLLGATGWYFLATEVDDMCFNYAKKNVEQNNLSDLIKVVKVPQKTALKEESEIIYDFCMCNPPFFGIT-
2b78A1          ----------------------------------------------------------------------
1f38A           TLELAGRVRRVYAIDRNPEAISTTEXNLQRHGLGDNVTLXEGDAPEALCKIPDI----------------
1dctA           DLGFQKAGFIICANEYDKSIWKTYESNHSAKLIKGDISKISSDEFPKCDGI-------------------
1xdzA           SLPIKICFLHVTIVDSLNKRITFLEKLSEALQLENTTFCHDRAETFGQRKDVRESYDIVTARAVARLSVL
1eg2A           ARVAIQEGRNSICTDAAPVFKEYYQKQLTFLRSYEIVEGAANFGAALQR---------------------
1ahhA           ---FATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCITSEQELSALADFAISKLGKVDILVNNAGG
1pjzA           MSWLSGQGYHVVGAELSEAAVERYFTERGEQPHITSQGDFKVYAAPGIEIWCGDFFALTARDIGHCAAFY
1ws6A1          GLEAASEGWEAVLVEKDPEAVRLLKENVRRTGLGARVEVFLPEAKAQGERF-------------------
1kp9A           MMRAVEKDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRI----------------
1rylA           ----------------------------------------------------------------------
1o89A2          STAVALLGYQVVAVSGRESTHEYLK----SLGASRVLP--------------------------------
1zbqA1          LVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAVANY-------------------------------
2o57A1          ARFLVRFGVSIDCLNIAPVQNKRNEEYNNQAGLADNITV-------------------------------
2esrA1          AIEAVSRGXAAVLVEKNRKAQAIIQDNIIXTKAENRFTLLKXEERAIDC--LTGRFDLVFLDPPY-----
2q07A1          ----------------------------------------------------------------------
1piwA2          ------MGAETYVISRSSRK----REDAMKMGADHYIA--------------------------------
2bzgA1          XKWFADRGHSVVGVEISELGIQEFFTEQNLSYSE--EPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNI
1ixkA           ----------------------------------------------------------------------
2b9eA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYVIYSTCTLTYIENEGVIEKAGAEIVDAGIEIGAPGWG
1ixkA           IHR-----TXDDIKFCQGLQXRLLEKGLKPGGILVYSTCSLEPEENEFVIDNFDVELLP--LKYGEPALT
2b9eA1          HA-------------LAGFQQRALCHALTFPSRLVYSTCSLCQEENEDVVRDALQQNPGARLAPALPAWP
2ar0A1          TNITRTFVHPTSNKQLCFXQHIIETLHPGGRAAVVVPDNVLFEGGKGTDIRRDLXDKCHLHTILRLPTTN
1sqfA2          IRRHPDIKWLRRDRQLQSEILDAIWPHLKTGGTLVYATCSVLPEENSLQIKAFLQRTAD--AELCETGTP
1sqwA1          ----------------------------------------------------------------------
1wxwA2          -------KGKKDVERAYRAYKEVNLRALKEGGILATASCSHHXTEPLXVAEAAQDAHRLLRVVEKRGQPF
1iq8A3          ----------------------------------------------------------------------
2apoA1          ----------------------------------------------------------------------
1r3eA1          ----------------------------------------------------------------------
1q7hA1          ----------------------------------------------------------------------
1im8A           ----------------------------------------------------------------------
1yzhA1          ---PWPKKRHEKRRLTYKTFLDTFKRILPENGEIHFKTDNRGLFEYLVSFSQYGXKLNGVWLDLHASDFE
1pgjA2          TGNAHFKDQGRRAQQLEAAGLRFLGMGISGGEEFFPGGTLSVWEEIRPIVEAAAAKADDGRPCVTMNGSG
2i6gA1          ----------------------------------------------------------------------
1zs7A1          ----------------------------------------------------------------------
1aqiA1          KYNLYGAFLEKAVR------------LLKPGGVLVFVVPATWVLEDFALLREFEGKTSVYYLGEVFPQKK
1uirA           GEDNPARLLY------TVEFYRLVKAHLNPGGVMGMQTGMILLRVHPVVHRTVYVRSYKNHIPGFFLNFG
2h00A1          -----EIMAEGGELEFVKRIIHDSLQLKKRLRWYSCMLGKKCSLAPKEELRIQGVPKVTY-TEFCQGRTM
2b78A1          ----------------------------------------------------------------------
1f38A           ----------------------------------------------------------------------
1dctA           ----------------------------------------------------------------------
1xdzA           SELCLPLVLFVALKAAAEEELNAGKKAITTLGGEL-----------------------------------
1eg2A           ----------------------------------------------------------------------
1ahhA           GGPKPFDMPMA-----------------------------------------------------------
1pjzA           DRAAMIALPADMRERY----VQHLEALMPQACSGLLITLEYDQALLEGPPFSVPQTWLHRVM----SGNW
1ws6A1          ----------------------------------------------------------------------
1kp9A           ----------------------------------------------------------------------
1rylA           ----------------------------------------------------------------------
1o89A2          ----------------------------------------------------------------------
1zbqA1          ----------------------------------------------------------------------
2o57A1          ----------------------------------------------------------------------
2esrA1          ----------------------------------------------------------------------
2q07A1          ----------------------------------------------------------------------
1piwA2          ----------------------------------------------------------------------
2bzgA1          GKFDXIWDRGALVAINPGDRKCYXFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGKICNIR-
1ixkA           ----------------------------------------------------------------------
2b9eA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           CRECRRFLPHVHNTPGFFIAVLRGARKxx
1ixkA           NPFARRLYPDVHETSGFFIAKIR------
2b9eA1          HRHCLRASPETTLSSGFFVAVIE------
2ar0A1          VLFFTKGTVANPNQDKNCTDDVW------
1sqfA2          EQPGKQNLPGAEEGDGFFYAKLI------
1sqwA1          -----------------------------
1wxwA2          DHPVLLNHPETHYLKFAVFQVL-------
1iq8A3          -----------------------------
2apoA1          -----------------------------
1r3eA1          -----------------------------
1q7hA1          -----------------------------
1im8A           -----------------------------
1yzhA1          GNVXTEYEQKFSNK-GQ------------
1pgjA2          -----------------------------
2i6gA1          -----------------------------
1zs7A1          -----------------------------
1aqiA1          VSAVLSLWDTQESESGFTPILWAEYPH--
1uirA           FLLASDAFDPAAFSEGVIEARIRERN---
2h00A1          RWAAWSFY---------------------
2b78A1          -----------------------------
1f38A           -----------------------------
1dctA           -----------------------------
1xdzA           -----------------------------
1eg2A           -----------------------------
1ahhA           -----------------------------
1pjzA           EVTKVGGQDTLHSSARGLKA---------
1ws6A1          -----------------------------
1kp9A           -----------------------------
1rylA           -----------------------------
1o89A2          -----------------------------
1zbqA1          -----------------------------
2o57A1          -----------------------------
2esrA1          -----------------------------
2q07A1          -----------------------------
1piwA2          -----------------------------
2bzgA1          -----------------------------
1ixkA           -----------------------------
2b9eA1          -----------------------------