[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL63125.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1iwmA.bssp"
#ERROR : Can't open dsspfile "1oltA.bssp"
#ERROR : Can't open dsspfile "1bobA.bssp"
#ERROR : Can't open dsspfile "1eyuA.bssp"
#ERROR : Can't open dsspfile "1m98A1.bssp"
#ERROR : Can't open dsspfile "1y9wA1.bssp"
#ERROR : Can't open dsspfile "1bmfA1.bssp"
#ERROR : Can't open dsspfile "1vkcA.bssp"
#ERROR : Can't open dsspfile "2bswA1.bssp"
#ERROR : Can't open dsspfile "1q2yA.bssp"
#ERROR : Can't open dsspfile "1xebA.bssp"
#ERROR : Can't open dsspfile "1m44A.bssp"
#ERROR : Can't open dsspfile "1b6bA.bssp"
#ERROR : Can't open dsspfile "1r30A.bssp"
#ERROR : Can't open dsspfile "2fiwA1.bssp"
#ERROR : Can't open dsspfile "1y9kA1.bssp"
#ERROR : Can't open dsspfile "1cm0A.bssp"
#ERROR : Can't open dsspfile "2g3aA1.bssp"
#ERROR : Can't open dsspfile "1i12A.bssp"
#ERROR : Can't open dsspfile "1vhsA.bssp"
#ERROR : Can't open dsspfile "2ozgA2.bssp"
#ERROR : Can't open dsspfile "1yx0A1.bssp"
#ERROR : Can't open dsspfile "1z4eA1.bssp"
#ERROR : Can't open dsspfile "1mk4A.bssp"
#ERROR : Can't open dsspfile "1s7fA1.bssp"
#ERROR : Can't open dsspfile "1s3zA.bssp"
#ERROR : Can't open dsspfile "1u6mA.bssp"
#ERROR : Can't open dsspfile "1tiqA.bssp"
#ERROR : Can't open dsspfile "2a6aA2.bssp"

## Summary of PDB Search
:471
    4e-20  14%  1iwmA  [b.125.1.2] OUTER MEMBRANE LIPOPROTEIN LOLB
    2e-17  19%  1oltA  [c.1.28.2] OXYGEN-INDEPENDENT COPROPORPHYRINOGEN III
    6e-14   9%  1bobA  [d.108.1.1] HISTONE ACETYLTRANSFERASE
    2e-13  10%  1eyuA  [c.52.1.6] TYPE II RESTRICTION ENZYME PVUII
    2e-09   6%  1m98A1 [a.175.1.1] ORANGE CAROTENOID PROTEIN A:2 -- 175
    6e-09  35%  1y9wA1 [d.108.1.1] ACETYLTRANSFERASE A:1 -- 140
    2e-08  13%  1bmfA1 [a.69.1.1] BOVINE MITOCHONDRIAL F1-ATPASE A:380 -- 510
    3e-06  34%  1vkcA  [d.108.1.1] PUTATIVE ACETYL TRANSFERASE
    5e-06  29%  2bswA1 [d.108.1.1] GLYPHOSATE N-ACETYLTRANSFERASE A:2 -- 146
    2e-05  23%  1q2yA  [d.108.1.1] SIMILAR TO HYPOTHETICAL PROTEINS
    2e-05  18%  1xebA  [d.108.1.1] HYPOTHETICAL PROTEIN PA0115
    3e-05  17%  1m44A  [d.108.1.1] AMINOGLYCOSIDE 2'-N-ACETYLTRANSFERASE
    5e-05  23%  1b6bA  [d.108.1.1] PROTEIN (ARYLALKYLAMINE N-ACETYLTRANSFERASE)
    6e-05  17%  1r30A  [c.1.28.1] BIOTIN SYNTHASE
    6e-05  30%  2fiwA1 [d.108.1.1] GCN5-RELATED N- A:2 -- 157
    7e-05  34%  1y9kA1 [d.108.1.1] IAA ACETYLTRANSFERASE A:1 -- 152
    8e-05  15%  1cm0A  [d.108.1.1] P300/CBP ASSOCIATING FACTOR
    8e-05  20%  2g3aA1 [d.108.1.1] ACETYLTRANSFERASE A:1 -- 137
    1e-04  26%  1i12A  [d.108.1.1] GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
    2e-04  21%  1vhsA  [d.108.1.1] SIMILAR TO PHOSPHINOTHRICIN ACETYLTRANSFERASE
    2e-04  20%  2ozgA2 [d.108.1.10] GCN5-RELATED N-ACETYLTRANSFERASE A:8 -- 290
    3e-04  20%  1yx0A1 [d.108.1.1] HYPOTHETICAL PROTEIN YSNE A:1 -- 151
    3e-04  26%  1z4eA1 [d.108.1.1] TRANSCRIPTIONAL REGULATOR A:4 -- 153
    3e-04  17%  1mk4A  [d.108.1.1] HYPOTHETICAL PROTEIN YQJY
    3e-04  14%  1s7fA1 [d.108.1.1] ACETYL TRANSFERASE A:1 -- 176
    4e-04  15%  1s3zA  [d.108.1.1] AMINOGLYCOSIDE 6'-N-ACETYLTRANSFERASE
    6e-04  20%  1u6mA  [d.108.1.1] ACETYLTRANSFERASE, GNAT FAMILY
    6e-04  29%  1tiqA  [d.108.1.1] PROTEASE SYNTHASE AND SPORULATION NEGATIVE
    7e-04   9%  2a6aA2 [c.55.1.9] HYPOTHETICAL PROTEIN TM0874 A:104 -- 193
:471

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxPFPCPGRCTFCPSSADAPKSYMPDSPVVLRAKRNRYDPYLQTAGRIKVYIENGHTPS
1iwmA           ----------------------------------------------------------------------
1oltA           -------------PF-CHKLCYFC------------GCNKIVTRQQHKADQYLDALEQEIVHRAPLFAGR
1bobA           ----------------------------------------------------------------------
1eyuA           ----------------------------------------------------------------------
1m98A1          ----------------------------------------------------------------------
1y9wA1          ----------------------------------------------------------------------
1bmfA1          ----------------------------------------------------------------------
1vkcA           ----------------------------------------------------------------------
2bswA1          ----------------------------------------------------------------------
1q2yA           ----------------------------------------------------------------------
1xebA           ----------------------------------------------------------------------
1m44A           ----------------------------------------------------------------------
1b6bA           ----------------------------------------------------------------------
1r30A           ----------------------------------------------------------------------
2fiwA1          ----------------------------------------------------------------------
1y9kA1          ----------------------------------------------------------------------
1cm0A           ----------------------------------------------------------------------
2g3aA1          ----------------------------------------------------------------------
1i12A           ----------------------------------------------------------------------
1vhsA           ----------------------------------------------------------------------
2ozgA2          ----------------------------------------------------------------------
1yx0A1          ----------------------------------------------------------------------
1z4eA1          ----------------------------------------------------------------------
1mk4A           ----------------------------------------------------------------------
1s7fA1          ----------------------------------------------------------------------
1s3zA           ----------------------------------------------------------------------
1u6mA           ----------------------------------------------------------------------
1tiqA           ----------------------------------------------------------------------
2a6aA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KIEAVIMGGTFSALPRGYREWFVANIYKALNDFPHWTSSADPTPNLEAEQIRNETAELRMVALTVETRPD
1iwmA           -------GKSPDSP--QWRQ--HQQDVRNLNQYQTRGAFAY---------------ISDQQKVYARFFWQ
1oltA           HVSQLWGGGTPTYLNKAQ----ISRLMKLLRENFQFNADAE---------------------ISIEVDPR
1bobA           ----------------------------------------------------------------------
1eyuA           -------------------------------------------------------------NKLLELWPH
1m98A1          -----------------------------------------------EDQLALIWFAYLEMGKTITIA--
1y9wA1          ----------------------------------------------------------------------
1bmfA1          ----------------------------------------------------------------------
1vkcA           ----------------------------------------------------------------------
2bswA1          ----------------------------------------------------------------------
1q2yA           ----------------------------------------------------------------------
1xebA           ----------------------------------------------------------------------
1m44A           ----------------------------------------------------------------------
1b6bA           ----------------------------------------------------------------------
1r30A           ----------------------------------------------DMPYLEQMVQGVKAMGLEACMTLG
2fiwA1          ----------------------------------------------------------------------
1y9kA1          ----------------------------------------------------------------------
1cm0A           ----------------------------------------------------------------------
2g3aA1          ----------------------------------------------------------------------
1i12A           ----------------------------------------------------------------------
1vhsA           ----------------------------------------------------------------------
2ozgA2          ----------------------------------------------------------------------
1yx0A1          ----------------------------------------------------------------------
1z4eA1          ----------------------------------------------------------------------
1mk4A           ----------------------------------------------------------------------
1s7fA1          ----------------------------------------------------------------------
1s3zA           ----------------------------------------------------------------------
1u6mA           ----------------------------------------------------------------------
1tiqA           ----------------------------------------------------------------------
2a6aA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           FINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAAEVVEATAILKDSAYKVCYHVMPGLPGSDPD
1iwmA           QTGQDRYRLLLPLGSTELELNAQPGNVQLVDNKGQRYTADDAEEMIGKLTGMPIPLNRQWILGLPGDATD
1oltA           EIELDVLDHLRAEGFNRLSMGVQDFNKEVQRLVNREQDEEFIFALLNHAREIGFTTNIDLIYGLPKQTPE
1bobA           ------------------------------------------------------------------SIVG
1eyuA           IQEYQDL--ALKHGINDIDNGGKLLQVLLITGLTVLPGREGNDAVDNAGQEYELKSIIDLTKGFSTHHHM
1m98A1          -APGAANMQFAETLQEIRQMTPLQQTQAMCDLANRTDTPICRTYASWSP-----NIKLGFWYELGRFMDQ
1y9wA1          ----------------------------------------------------------------------
1bmfA1          ----------------------------------------------------------------------
1vkcA           ----------------------------------------------------------------------
2bswA1          ----------------------------------------------------------------------
1q2yA           ----------------------------------------------------------------------
1xebA           ----------------------------------------------------------------------
1m44A           ----------------------------------------------------------------------
1b6bA           ----------------------------------------------------------------------
1r30A           TLSESQAQRLANAGLDYYNHNLDT-SPEFYGNIITTRTYQERLDTLEKVRDAGIKVCSGGIVGLGETVKD
2fiwA1          ----------------------------------------------------------------------
1y9kA1          ----------------------------------------------------------------------
1cm0A           ----------------------------------------------------------------------
2g3aA1          ----------------------------------------------------------------------
1i12A           ----------------------------------------------------------------------
1vhsA           ----------------------------------------------------------------------
2ozgA2          ----------------------------------------------------------------------
1yx0A1          ----------------------------------------------------------------------
1z4eA1          ----------------------------------------------------------------------
1mk4A           ----------------------------------------------------------------------
1s7fA1          ----------------------------------------------------------------------
1s3zA           ----------------------------------------------------------------------
1u6mA           ----------------------------------------------------------------------
1tiqA           ----------------------------------------------------------------------
2a6aA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RDLEMVREIFSNPSYMPDCVKIYPLYVVPNTELSEDWRRGLYKSYDEETWLELLAKIYASIPRWVRVMRF
1iwmA           YKLDDQYRLSEITYSQNGKNWKVVYGGYDTKTQPAMPANMELTDGGQR----------------------
1oltA           SFAFTLKRVA---ELNPDRLSVFNYAHLPTIFAAQ-RKIKDADLPSPQQKLDILQETIA-----------
1bobA           ENAVQFSPLFTYPIYGDSEKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVR-
1eyuA           NPVIRGIAIEAIYRLEPKDLEFYYDKWERKW-----YSDGHKDINNPKIPVKY-----------------
1m98A1          GLVAPIPEGYK----LSANANAILVTIQGID---------------------------------------
1y9wA1          ----------------------------------------------------------------------
1bmfA1          LELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSK-
1vkcA           ----------------------------------------------------------------------
2bswA1          ----------------------------------------------------------------------
1q2yA           ----------------------------------------------------------------------
1xebA           ----------------------------------------------------------------------
1m44A           ----------------------------------------------------------------------
1b6bA           ----------------------------------------------------------------------
1r30A           RLLLQLANL----PTPPESVPINMLVKVKGTPLAD---------NDDVDAFDFI--------RTIAVARI
2fiwA1          ----------------------------------------------------------------------
1y9kA1          ----------------------------------------------------------------------
1cm0A           ----------------------------------------------------------------------
2g3aA1          ----------------------------------------------------------------------
1i12A           ----------------------------------------------------------------------
1vhsA           ----------------------------------------------------------------------
2ozgA2          ----------------------------------------------------------------------
1yx0A1          ----------------------------------------------------------------------
1z4eA1          ----------------------------------------------------------------------
1mk4A           ----------------------------------------------------------------------
1s7fA1          ----------------------------------------------------------------------
1s3zA           ----------------------------------------------------------------------
1u6mA           ----------------------------------------------------------------------
1tiqA           ----------------------------------------------------------------------
2a6aA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GRDIPLHHVLDGPRWGNMRQIVLKHMERLGLKCQEIRCREVGIKLANNVPIQPGPVEVKKTEYEASGGLE
1iwmA           ----------------------------------------------------------------------
1oltA           ----------------------------------------------------------------------
1bobA           -DEAKWVDCFAEERKTHNLSDVFEKVSEYSLNGEEFVVYKSSHRRVQIFSLLFIEAANYIDETDPSWQIY
1eyuA           ----------------------------------------------------------------------
1m98A1          ----------------------------------------------------------------------
1y9wA1          ----------------------------------------------------------------------
1bmfA1          ----------------------------------------------------------------------
1vkcA           ----------------------------------------------------------------------
2bswA1          ----------------------------------------------------------------------
1q2yA           ----------------------------------------------------------------------
1xebA           ----------------------------------------------------------------------
1m44A           ----------------------------------------------------------------------
1b6bA           ----------------------------------------------------------------------
1r30A           --MMPTSYV----RLSAGREQMNEQTQAMCFMA-------------------------------------
2fiwA1          ----------------------------------------------------------------------
1y9kA1          ----------------------------------------------------------------------
1cm0A           ----------------------------------------------------------------------
2g3aA1          ----------------------------------------------------------------------
1i12A           ----------------------------------------------------------------------
1vhsA           ----------------------------------------------------------------------
2ozgA2          ----------------------------------------------------------------------
1yx0A1          ----------------------------------------------------------------------
1z4eA1          ----------------------------------------------------------------------
1mk4A           ----------------------------------------------------------------------
1s7fA1          ----------------------------------------------------------------------
1s3zA           ----------------------------------------------------------------------
1u6mA           ----------------------------------------------------------------------
1tiqA           ----------------------------------------------------------------------
2a6aA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           IFLEAVGPDDTLYAILRLRIPNRPHRPELYKAALVRELHVYGPAVPVGKQGIWWQHSGMGRELMRLAEEI
1iwmA           ----------------------------------------------------------------------
1oltA           ----------------------------------------------------------------------
1bobA           WLLNKKTKELIGFVTTYKYWHYIDKK---------FRAKISQFLI-----FPPYQNKGHGSCLYEAIIQS
1eyuA           ----------------------------------------------------------------------
1m98A1          ----------------------------------------------------------------------
1y9wA1          ------------------------------------------------------RHDGYGSQLLHEIEGI
1bmfA1          ----------------------------------------------------------------------
1vkcA           ----------------------------------VKIAYIYDIEVVKWARG-----LGIGSALLRKAEEW
2bswA1          ----------------------------------------------------GYREQKAGSSLIKHAEEI
1q2yA           -----------------------------------------------------HRSAGVGGIIMKALEKA
1xebA           -----------------------------------------------------ARGQGLGHQLXERALQA
1m44A           -----------------------------HAAVIQRRLIYRGNALRCGYEGVAWRGQRLVSALLDAVEQV
1b6bA           -----------------------------------------------------FRQQGKGSVLLWRYLHH
1r30A           ----------------------------------------------------------------------
2fiwA1          -----------------------------------------------------YVGRDVGTTLIDALEKL
1y9kA1          -----------------------------------------------------LQGKGIGKKLLRHAVET
1cm0A           -----------------------------------------------------EQVKGYGTHLMNHLKEY
2g3aA1          ------------------------------------------------------RGQGIAPKLLAXAEEE
1i12A           -----------------------------------------------------YQGQGLGKLLIDQLVTI
1vhsA           -----------------------------------------------------CRGKGVGSYLLQEALRI
2ozgA2          -----------------------------------------------------YRGDGAAIALIQHTLQE
1yx0A1          -----------------------------------------------------HLRKGVAKQVLQHIIEE
1z4eA1          -----------------------------------------------------ARGQGIGSQLVCWAIER
1mk4A           ----------------------------------------------------DFRKMQIGKQLYDVFIET
1s7fA1          ----------------------------------------------------SFQGQGIMSQSLQALMTH
1s3zA           ----------------------------------------------------SFRQRGVAKQLIAAVQRW
1u6mA           ----------------------------------------------------RFRGMGIGSKLLDALPEV
1tiqA           ----------------------------------------------------SFQKHGLGKHLLNKAIEI
2a6aA2          -----------------------------------------------------LNPLKEPSVVSDEELEE


                         .         .         +         .         .         .         .:490
query           AGEFGALKIAVISGVGVREYYRKLGYERCGPYMCKPLGAPLGVADDGLVxx
1iwmA           ---------------------------------------------------
1oltA           ---------------------------------------------------
1bobA           WLEDKSITEITVPNEAFDDLRDRNDIQRLRKL-------------------
1eyuA           ---------------------------------------------------
1m98A1          ---------------------------------------------------
1y9wA1          AKEKGCRLILLDSSFQAPEFYKKHGYREYGVVEDHPKG-------------
1bmfA1          ---------------------------------------------------
1vkcA           AKERGAKKIVLRVEIDAVKWYEERGYKARALIMEKPI--------------
2bswA1          LRKRGADLLWCNARTSASGYYKKLGFSEQG---------------------
1q2yA           AADGGASGFILNAQTQAVPFYKKHGYRVLS---------------------
1xebA           AERLWLDTPVYLSAAHLQAYYGRYGFVAVTEV-------------------
1m44A           MRGAYQLGARLYASRGWLPWHGPTSVLAPTGPFVLPIDISL----------
1b6bA           VGAQPAVRRAVLMCDALVPFYQRFGFHPAGP--------------------
1r30A           ---------------------------------------------------
2fiwA1          AGARGALILTVDASDNAAEFFAKRGYV------------------------
1y9kA1          AKGYGXSKLEVNSSVSQLALYQKCGFRIFS---------------------
1cm0A           HIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATL--
2g3aA1          ARKRGCXGAYIDTXPDALRTYERYGFTKIGSLGPLSSGQ------------
1i12A           GFDYGCYKIILDCDEKNVKFYEKCGFSNAGVEM------------------
1vhsA           APNLGIRSLXAFHNKPSLKLFEKHGFAEWG---------------------
2ozgA2          ISEQDIPI--SVLYPATQRLYRKAGYEQAGSSCV-----------------
1yx0A1          AEKRGYERLSLETGSMARKLYESFGFQYCEPF-------------------
1z4eA1          AKERGCHLITDKQRPDALRFYEQLGFKASH---------------------
1mk4A           VKQRGCTRVTSPVNKVSIAYHTKLGFDIEK---------------------
1s7fA1          YARRGDIRRFVIDNQASNAVARRNHFTLEGCMK------------------
1s3zA           GTNKGCREMASPENTISQKVHQALGFEETE---------------------
1u6mA           AKASGKQALGLFDNPGARKLYASKGFKDVTTMT------------------
1tiqA           ALERNKKNIWLGKNENAIAFYKKXGFVQTG---------------------
2a6aA2          ITKEFSPKIVLKLISPAVLVEESERLFREK---------------------