[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL63374.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1mbbA1.bssp"
#ERROR : Can't open dsspfile "1ahuA2.bssp"
#ERROR : Can't open dsspfile "1w1oA2.bssp"
#ERROR : Can't open dsspfile "1fiqB2.bssp"
#ERROR : Can't open dsspfile "1jroA4.bssp"
#ERROR : Can't open dsspfile "1hskA1.bssp"
#ERROR : Can't open dsspfile "1ffuC2.bssp"
#ERROR : Can't open dsspfile "1kuuA.bssp"
#ERROR : Can't open dsspfile "1f0xA2.bssp"
#ERROR : Can't open dsspfile "1t3qC2.bssp"
#ERROR : Can't open dsspfile "1i19A2.bssp"
#ERROR : Can't open dsspfile "1f0xA1.bssp"
#ERROR : Can't open dsspfile "1diiA1.bssp"
#ERROR : Can't open dsspfile "1ahuA1.bssp"

## Summary of PDB Search
:327
    1e-24  10%  1mbbA1 [d.145.1.2] URIDINE DIPHOSPHO-N-ACETYLENOLPYRUVYLGLUCOSAMINE
    4e-24  18%  1ahuA2 [d.145.1.1] VANILLYL-ALCOHOL OXIDASE A:6 -- 273
    5e-24  19%  1w1oA2 [d.145.1.1] CYTOKININ DEHYDROGENASE 1 A:40 -- 245
    5e-22  10%  1fiqB2 [d.145.1.3] XANTHINE OXIDASE B:224 -- 414
    1e-19   9%  1jroA4 [d.145.1.3] XANTHINE DEHYDROGENASE, CHAIN A A:179 -- 345
    3e-18  15%  1hskA1 [d.145.1.2] UDP-N-ACETYLENOLPYRUVOYLGLUCOSAMINE REDUCTASE
    4e-18  14%  1ffuC2 [d.145.1.3] CUTM, FLAVOPROTEIN OF CARBON MONOXIDE C:1 -- 177
    8e-18  13%  1kuuA  [d.153.2.1] CONSERVED PROTEIN
    1e-17  14%  1f0xA2 [d.145.1.1] D-LACTATE DEHYDROGENASE A:9 -- 273
    5e-15  15%  1t3qC2 [d.145.1.3] QUINOLINE 2-OXIDOREDUCTASE MEDIUM SUBUNIT C:1 --
    3e-14  16%  1i19A2 [d.145.1.1] CHOLESTEROL OXIDASE A:57 -- 273
    2e-07  14%  1f0xA1 [d.58.32.2] D-LACTATE DEHYDROGENASE A:274 -- 567
    6e-06  43%  1diiA1 [d.58.32.1] P-CRESOL METHYLHYDROXYLASE A:243 -- 521
    1e-04  38%  1ahuA1 [d.58.32.1] VANILLYL-ALCOHOL OXIDASE A:274 -- 560
:327

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRPKSVEELVELMKEANRDRRRLLPICKGSKAHLGPPVEYDEELQLWDMPKVLEVDEEEMVVRTSACISA
1mbbA1          -CAEDEQQLLNAWQYATAEGQPVLILGEGSN-VLFLEDYRGTVIINRIKGIEIHDEPDAWYLHVGAGENW
1ahuA2          -APRNVADVQSIVGLANKFSFPLWPISIGRNSGYGGPRVSGSVVLDMGMNRVLEVNVEGAYCVVEPGVTY
1w1oA2          -YPSSTGDLVALLSAANSTPGWPYTIAFRGRGHLMGQAFAPGGVVVNAAPPRINVSADGRYVDAGGEQVW
1fiqB2          -QASTLKELLDLKAQHPE--AKLVVGNTEIGIEMKKNQLFPMIICPAWIPELNAVEHGPEGISFGAACAL
1jroA4          -LPETSDALADWYLAHPE--ATLIAGGTDVSLWVTALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTI
1hskA1          -TPTKNEEVQAVVKYAYQNEIPVTYLGNGSNIII---REGGIRGIVISLLSLDHIEVSDDAIIAGSGAAI
1ffuC2          -APKSVGEAVALLGQLGS---DAKLLAGGHSLLPMMFAQPEHLIDINRIPELRGIREEGSTVVIGAMTVE
1kuuA           ------------------------------------------------AYRVSSRSFPNRTTSIQEERVA
1f0xA2          VFPGSLLELWRVLKACVTADKIILMQAANTGLTEGSTPNGNDYISTLRLDKL-HVLGKGEQVLAYPGTTL
1t3qC2          -APASLQEVIQVLADDPD--ARIIAGGQSLLPLLAFLVYPSCLVDLRNVSELFEISQSAGILSVGAMVTH
1i19A2          -SPKTPQDVVRLANWAHEHDYKIRPRGAMTPLTVEKGANVEKVILADTMTHLNGITVNTATVTAGAGASI
1f0xA1          ----------------------------------------------------------------------
1diiA1          ----------------------------------------------------------------------
1ahuA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VELQEELRKRGRRLALDPPLFRRSSIGGILSTNFYGPMAYRYMTPRDQLLSVKIVTGKGEFMKFGAPVVK
1mbbA1          HRLVKYTLQEGMPGLENLA-LIPGCVGSSPIQNIGA----YGVELQRVCAYVDSVELATGKQVRLTA--K
1ahuA2          HDLHNYLEANNLRDKLWLDVPDLGGGSVLGNAVERGVGYTPYGDHWMMHSGMEVVLANGELLRTGMLKPE
1w1oA2          IDVLRASLARGVAPRSWTDYLYLT-VGGTLSNAGISGQAFRHGPQISNVLEMDVITGHGEMVTC-----S
1fiqB2          SSVEKTLLEAVAKLPTQKTEVF-RGVLEQLRWFALGGNIITASPISDLNPVFMASGTKLTIVSRGTRRTV
1jroA4          AALRAFAEGPHPALAGLLRRFASEQVRQVATINIANGSPIGDGPPALIAMGASLTLRRGQERRRM-----
1hskA1          IDVSRVARDYALTG-LEFACGIPGSIGGAVYMNAGA----YGGEVKDCIDYALCVNEQGSLIKLT----T
1ffuC2          NDLISSPIVQARLPLLAEAAKLIADNRGTIGGDIAHGDPGNDHPALSIAVEAHFVLEGPN------GRRT
1kuuA           VVPVE-GHERDVFRNPYIA-YNCIRIVGDTAVVSNGADKVALGMNLRDAIGLSLLAMDYE--------KD
1f0xA2          YSLEKALKPLGREPHSVIGSSCGASVIGGICNNS-GGSLVQRGPAYTEMSLFARINEDGK------LTLV
1t3qC2          FRNKTDPTVAKCVPILPKVLAHAVRNRGTLGGSLAHADAGAEMPFLMATLGATMYIASSAG---------
1i19A2          EAIVTELQKHDLGWANLPA-PGVLSIGGALAVNQTTLPGHTYGSLSNLVTELTAVVWNGTTY-----ALE
1f0xA1          ----------------------------------------------------------------------
1diiA1          ----------------------------------------------------------------------
1ahuA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DVAGYNIKRLIAGSWGTLAVLVEAYMRIYALPESVAVMATGRKSLQELRKLHVAGAAEADGVLYLRFEGV
1mbbA1          ECRFGYRDSIFKHEYQDRFAIVAVGLRLPKEWQPVLTYG-------------------------------
1ahuA2          DQPWSKIAHDGLFSQSNMGIVTKIGIWLMPNP--------------------------------------
1w1oA2          KQLNADLFDAVLGGLGQFGVITRARIAVE-----------------------------------------
1fiqB2          PMDHTFFPSYRKTLLGPEEILLSIEIPYS-----------------------------------------
1jroA4          -PLEDFFLEYRKQDRRPGEFVESVTLPKSA----------------------------------------
1hskA1          KELELDYRNSIIQ--KEHLVVLEAAFTLA-----------------------------------------
1ffuC2          VPADGFFLGTYMTLLEENEVMVEIRVPAF-----------------------------------------
1kuuA           ELNTPRIAAAINGSEAFIGIVTADGLMVSRVPEETPVYISTYEQTEPAATEFKAGSPEE-----------
1f0xA2          NHLGIDLGETPEQILSKL----------------------------------------------------
1t3qC2          -VRSVSATDFMKGHYFTDEVLVRVEIPIP-----------------------------------------
1i19A2          TYQRNDPRITPLLTNLGRCFLTSVTMQAG-----------------------------------------
1f0xA1          -----------------TEIRRHILANFENLPVAGEYMH--RDIYDIAELPPRMKNWRDKYEHHLLLKMA
1diiA1          ----------------------------------------------------------------------
1ahuA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KSEVEYRLSKAGRGDVFYDREAEEKWSSVTEAEELFASNEIAKVVAPPASLPETPPGVKYLRYPLLGVMY
1mbbA1          ----------------------------------------------------------------------
1ahuA2          ----------------------------------------------------------------------
1w1oA2          ----------------------------------------------------------------------
1fiqB2          ----------------------------------------------------------------------
1jroA4          ----------------------------------------------------------------------
1hskA1          ----------------------------------------------------------------------
1ffuC2          ----------------------------------------------------------------------
1kuuA           ----------------------------------------------------------------------
1f0xA2          ----------------------------------------------------------------------
1t3qC2          ----------------------------------------------------------------------
1i19A2          ----------------------------------------------------------------------
1f0xA1          GDGVGEDYFKQAEGDFFVCTPEEGSIRYQAVHSDEVEDILALDIALRRNDTEWDSQLVHKLYYFMCYVFH
1diiA1          ----------------------------------------------------------------------
1ahuA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VAGPPPAGVKAYWLKPQRKWDVENRDLMEKIKRVLDPNGVLSPGRLx
1mbbA1          -----------------------------------------------
1ahuA2          -----------------------------------------------
1w1oA2          -----------------------------------------------
1fiqB2          -----------------------------------------------
1jroA4          -----------------------------------------------
1hskA1          -----------------------------------------------
1ffuC2          -----------------------------------------------
1kuuA           -----------------------------------------------
1f0xA2          -----------------------------------------------
1t3qC2          -----------------------------------------------
1i19A2          -----------------------------------------------
1f0xA1          QDYIVKKGVDVYPAEHNVGHLYKAPETLQKFYRENDPTNSMNPGIG-
1diiA1          -----------------QSYGPVKRKLEHAIKRAVDPNNILAPGR--
1ahuA1          ------------------------LRFNEVLKNAVDPNGIIAPGK--