[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL63787.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2yziA1.bssp"
#ERROR : Can't open dsspfile "2ef7A1.bssp"
#ERROR : Can't open dsspfile "2o16A3.bssp"
#ERROR : Can't open dsspfile "2j9lA1.bssp"
#ERROR : Can't open dsspfile "2rifA1.bssp"
#ERROR : Can't open dsspfile "3ddjA2.bssp"
#ERROR : Can't open dsspfile "2nycA1.bssp"
#ERROR : Can't open dsspfile "2v8qE1.bssp"
#ERROR : Can't open dsspfile "2yzqA1.bssp"
#ERROR : Can't open dsspfile "1pvmA4.bssp"
#ERROR : Can't open dsspfile "2rc3A1.bssp"
#ERROR : Can't open dsspfile "1o50A3.bssp"
#ERROR : Can't open dsspfile "2v8qE2.bssp"
#ERROR : Can't open dsspfile "1xkfA3.bssp"
#ERROR : Can't open dsspfile "1zfjA4.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "3ddjA1.bssp"
#ERROR : Can't open dsspfile "1pbjA3.bssp"
#ERROR : Can't open dsspfile "1yavA3.bssp"
#ERROR : Can't open dsspfile "2ouxA2.bssp"
#ERROR : Can't open dsspfile "1b3oB4.bssp"
#ERROR : Can't open dsspfile "2d4zA3.bssp"
#ERROR : Can't open dsspfile "1f1zA2.bssp"
#ERROR : Can't open dsspfile "1vr9A3.bssp"
#ERROR : Can't open dsspfile "2yzqA2.bssp"
#ERROR : Can't open dsspfile "2ooxE1.bssp"
#ERROR : Can't open dsspfile "1nfbA4.bssp"

## Summary of PDB Search
:142
    8e-24  32%  2yziA1 [d.37.1.1] HYPOTHETICAL PROTEIN PH0107 A:4 -- 135
    6e-22  35%  2ef7A1 [d.37.1.1] HYPOTHETICAL PROTEIN ST2348 A:1 -- 127
    1e-21  28%  2o16A3 [d.37.1.1] ACETOIN UTILIZATION PROTEIN ACUB, PUTATIVE A:20
    1e-20  24%  2j9lA1 [d.37.1.1] CHLORIDE CHANNEL PROTEIN 5 A:578 -- 746
    2e-20  31%  2rifA1 [d.37.1.1] CONSERVED PROTEIN WITH 2 CBS DOMAINS A:2 -- 132
    3e-19  22%  3ddjA2 [d.37.1.1] CBS DOMAIN-CONTAINING PROTEIN A:1 -- 135
    4e-19  22%  2nycA1 [d.37.1.1] NUCLEAR PROTEIN SNF4 A:181 -- 320
    4e-18  17%  2v8qE1 [d.37.1.1] 5'-AMP-ACTIVATED PROTEIN KINASE SUBUNIT GAMMA-1
    6e-18  31%  2yzqA1 [d.37.1.1] PUTATIVE UNCHARACTERIZED PROTEIN PH1780 A:123 --
    1e-17  24%  1pvmA4 [d.37.1.1] CONSERVED HYPOTHETICAL PROTEIN TA0289 A:1 -- 142
    1e-17  30%  2rc3A1 [d.37.1.1] CBS DOMAIN A:23 -- 149
    2e-16  18%  1o50A3 [d.37.1.1] CBS DOMAIN-CONTAINING PREDICTED PROTEIN TM0935
    3e-16  12%  2v8qE2 [d.37.1.1] 5'-AMP-ACTIVATED PROTEIN KINASE SUBUNIT GAMMA-1
    4e-16  19%  1xkfA3 [d.37.1.1] HYPOTHETICAL PROTEIN RV2626C A:2 -- 124
    4e-16  15%  1zfjA4 [d.37.1.1] INOSINE MONOPHOSPHATE DEHYDROGENASE A:95 -- 220
    5e-16   8%  1e6vC  [d.58.31.1] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    1e-15  22%  3ddjA1 [d.37.1.1] CBS DOMAIN-CONTAINING PROTEIN A:136 -- 276
    3e-15  28%  1pbjA3 [d.37.1.1] HYPOTHETICAL PROTEIN A:2 -- 121
    6e-15  17%  1yavA3 [d.37.1.1] HYPOTHETICAL PROTEIN BSU14130 A:13 -- 144
    1e-14  23%  2ouxA2 [d.37.1.1] MAGNESIUM TRANSPORTER A:136 -- 262
    5e-14  13%  1b3oB4 [d.37.1.1] PROTEIN (INOSINE MONOPHOSPHATE DEHYDROGENASE 2)
    2e-13  13%  2d4zA3 [d.37.1.1] CHLORIDE CHANNEL PROTEIN A:527 -- 606 A:691 --
    3e-13  14%  1f1zA2 [c.52.1.16] TNSA ENDONUCLEASE A:8 -- 168
    3e-13  17%  1vr9A3 [d.37.1.1] CBS DOMAIN PROTEIN/ACT DOMAIN PROTEIN A:1 -- 121
    5e-13  22%  2yzqA2 [d.37.1.1] PUTATIVE UNCHARACTERIZED PROTEIN PH1780 A:1 --
    8e-11  19%  2ooxE1 [d.37.1.1] HYPOTHETICAL PROTEIN C1556.08C IN CHROMOSOME I
    2e-07   7%  1nfbA4 [d.37.1.1] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE 2 A:112 --
:142

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPVDN
2yziA1          -----YXTKKLLGVKPSTSVQEASRLXXEFDVGSLVVIND-DGNVVGFFTKSDIIRRIVPGLPYDIPVER
2ef7A1          -----YXKTQVISVTKDAKLNDIAKVXTEKNIGSVIVVDGNK--PVGIITERDIVKAIGKGKSLETKAEE
2o16A3          ------------------TLNDAKHLMEALDIRHVPIV-DANKKLLGIVSQRDLLAAQESSLQFETPLFE
2j9lA1          MKPRRNDPLLTVLTQDSMTVEDVETIISETTYSFPVVVSRESQRLVGFVLRRDLIISIENARKPTLKLRN
2rifA1          IRTSELLKRPPVSLPETATIREVATELAKNRVGLALTARDNPKRPVAVVSERDILRAVAQRLDLDGPAMP
3ddjA2          --------KNPPILSKEDRLGSAFKKINEGGIGRIIVANE---KIEGLLTTRDLLSTVESYCCSTTPIID
2nycA1          --LNIITQDNMKSCQMTTPVIDVIQMLTQGRVSSVPII-DENGYLINVYEAYDVLGLIKGG--LSLSVGE
2v8qE1          --LQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVV-DEKGRVVDIYSKFDVINLAAEKTYKALQHRS
2yzqA1          VEIEPYYQRYVSIVWEGTPLKAALKALLLSNSMALPVV-DSEGNLVGIVDETDLLRDSEIVR-PNKPVAE
1pvmA4          MRVEKIMNSNFKTVNWNTTVFDAVKIMNENHLYGLVV-KDDNGNDVGLLSERSIIKRFIPKKPDEVPIRL
2rc3A1          -------GHTVVAIGPDDSVFNAMQKMAADNIGALLVMKDEKLVGILTERDFSRKSYLLDKPVKDTQVKE
1o50A3          KDVCKLISLKPTVVEEDTPIEEIVDRILEDPVTRTVYV-ARDNKLVGMIPVMHLLKVSGFHFFLIAKNAS
2v8qE2          -----PTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKWREVYLQ
1xkfA3          --ARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLA--AGLDPNTAT
1zfjA4          -----GVIIDPFFLTPEHKVSEAEELXQRYRISGVPIV-ETLANRKLVGIITNRDXRFISDYN-APISEH
1e6vC           --------IAKELLETEIFDPARSGVRGATVHGHALR--LDENGLMLHALRRYRLNEETGEVEYVKDQVG
3ddjA1          FPVKVFXSTKVQTIYKEVRLDQAVKLXLRRGFRRLPVI-DDDNKVVGIVTVVNAIKQLAKAVFYGKVVKD
1pbjA3          -----------------ASLEDVLRNYVENAKGSSVVVKEGVR--VGIVTTWDVLEAIAEGDDLAEKVWE
1yavA3          -------ADKVAHVQVGNNLEHALLVLTKTGYTAIPVL-DPSYRLHGLIGTNMIMNSIFGLELDQITVEE
2ouxA2          --AGAIXTTEFVSIVANQTVRSAXYVLKNQADXAETIYYDQENHLVGVISLRDLIV-----NDDDTLIAD
1b3oB4          -----------------------------QGFITDPVVLSPKDRVRCGIPITDTGRMGS---RLVGIIIM
2d4zA3          IQVGDIMVRDVTSIASTSTYGDLLHVLRQTKLKFFPFVDTPDTNLLGSIDRTEVEGEQREKNVVVNFETC
1f1zA2          -------------IKEGRGQGHGKDYIPWLTVQEVPSSGRSHRIY-SHKTGRVHHLLSD----LELAVFL
1vr9A3          -----WVTQDFPXVEESATVRECLHRXRQYQTNECIVK-DREGHFRGVVNKEDLL-----DLDLDSSVFN
2yzqA2          -----------------IMTQNPVTITLPATVRSFPVV-NKEGKLVGIISVKRIML--------------
2ooxE1          -------SFRLIVFDVTLFVKTSLSLLTLNNIVSAPLWDSEANKFAGLLTMADFVNVIKYYYQEVERKIG
1nfbA4          ----------------------------------------------GFITDPVV------------LSPG


                         .         .         *         .         .         .         .:140
query           IMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKESDVIERLVEYAEERIDExxx
2yziA1          IXTRNLITANVNTPLGEVLRKXAEHRIKHILIEEEGKIVGIFTLSDLLEAS-------------------
2ef7A1          FXTASLITIREDSPITGALALXRQFNIRHLPVVDKGNLKGIISIRDITRAID------------------
2o16A3          VMHTDVTSVAPQAGLKESAIYMQKHKIGCLPVVAKDVLVGIITDSDFV---TIAINLLELQEE-------
2j9lA1          ILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLKH--------------------
2rifA1          IANS-PITVLDTDPVHVAAEKMRRHNIRHVVVVNNGELVGVLSIRDLCFERAILLEL-------------
3ddjA2          YXTPNPVTVYNTSDEFTAINIXVTRNFGSLPVVDNDKPVGIVTEREFLL---------------------
2nycA1          ALMRRSYTCTKNDKLSTIMDNIRKARVHRFFVVDDGRLVGVLTLSDILKY--------------------
2v8qE1          HYFEGVLKCYLHETLEAIINRLVEAEVHRLVVVDHDVVKGIVSLSDILQA--------------------
2yzqA1          IMTRDVIVATPHMTVHEVALKMAKYSIEQLPVIREGDLIGLIRDFDLLKV--------------------
1pvmA4          VMRKPIPKVKSDYDVKDVAAYLSENGLERCAVVDPGRVVGIVTLTDLSRY--------------------
2rc3A1          IMTRQVAYVDLNNTNEDCMALITEMRVRHLPVLDDGKVIGLLSIGDLVKD--------------------
1o50A3          EIMLDPVYVHMDTPLEEALKLMIDNNIQEMPVVDKGEIVGDLNSLEILLA--------------------
2v8qE2          DSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDSGNTLYILTHKRILKF--------------------
1xkfA3          AGELAIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARH--------------------
1zfjA4          XTSEHLVTAAVGTDLETAERILHEHRIEKLPLVDSGRLSGLITIKDIEKV--------------------
1e6vC           IELDEPIPVGAPADEDDLKERTTIYRIDGTPYREDEELLQVVQRIHELRT--------------------
3ddjA1          VXVTNLVTIDELASVNRAAAEXIVKRIGSLLILNDNTIRGIITERDLLIA--------------------
1pbjA3          VXERDLVTISPRATIKEAAEKXVKNVVWRLLVEEDDEIIGVISATDILR---------------------
1yavA3          VMLTDIPRLHINDPIMKGFGMVINNGF-VCVENDEQVFEGIFTRRVVLKE--------------------
2ouxA2          ILNERVISVHVGDDQEDVAQTIRDYDFLAVPVTDDDHLLGIVTVDDII----------------------
1b3oB4          TKREDLVVAPAGITLKEANEILQRSKKGKLPIVNDDELVAIIARTDLKK---------------------
2d4zA3          RIDQSPFQLVEGTSLQKTHTLFSLLGLDRAYVTSMGKLVGVVALAEIQAA--------------------
1f1zA2          SLEWSVLDIREQFPLLPSDTRQIAIDSGIKHPVIRGSTDFLVDCKDGPFE--QFAIQVKPAAALQDE---
1vr9A3          KVSLPDFFVHEEDNITHALLLFLEHQEPYLPVVDEXRLKGAVSLHDFLEA--------------------
2yzqA2          -VKRDVPVVKENDTLKKAAKLMLEYDYRRVVVVDKGKPVGILTVGDIIRR--------------------
2ooxE1          AIPPETIYVHPMHSLMDACLAMSKSRARRIPLIGSEMIVSVLTQYRILKF--------------------
1nfbA4          IPITRMGSAPAGITLKEANEILQRSKKGKLPIVNDDEVAIIAN---------------------------


                         +         .         .         .         .         *         .:210
query           xx
2yziA1          --
2ef7A1          --
2o16A3          --
2j9lA1          --
2rifA1          --
3ddjA2          --
2nycA1          --
2v8qE1          --
2yzqA1          --
1pvmA4          --
2rc3A1          --
1o50A3          --
2v8qE2          --
1xkfA3          --
1zfjA4          --
1e6vC           --
3ddjA1          --
1pbjA3          --
1yavA3          --
2ouxA2          --
1b3oB4          --
2d4zA3          --
1f1zA2          --
1vr9A3          --
2yzqA2          --
2ooxE1          --
1nfbA4          --