[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL64120.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vfrA.bssp"
#ERROR : Can't open dsspfile "1ywqA1.bssp"
#ERROR : Can't open dsspfile "2ifaA1.bssp"
#ERROR : Can't open dsspfile "1bkjA.bssp"
#ERROR : Can't open dsspfile "1ds7A.bssp"
#ERROR : Can't open dsspfile "1zchA1.bssp"
#ERROR : Can't open dsspfile "1noxA.bssp"
#ERROR : Can't open dsspfile "1vkwA.bssp"
#ERROR : Can't open dsspfile "2freA1.bssp"
#ERROR : Can't open dsspfile "2b67A1.bssp"

## Summary of PDB Search
:274
    1e-27  15%  1vfrA  [d.90.1.1] NAD(P)H\:FMN OXIDOREDUCTASE
    2e-26  16%  1ywqA1 [d.90.1.1] NITROREDUCTASE FAMILY PROTEIN A:2 -- 200
    3e-24  18%  2ifaA1 [d.90.1.1] HYPOTHETICAL PROTEIN SMU.260 A:2 -- 200
    7e-22  30%  1bkjA  [d.90.1.1] NADPH-FLAVIN OXIDOREDUCTASE
    1e-20  17%  1ds7A  [d.90.1.1] FMN-DEPENDENT NITROREDUCTASE
    5e-20  30%  1zchA1 [d.90.1.1] HYPOTHETICAL OXIDOREDUCTASE YCND A:1 -- 249
    1e-18  26%  1noxA  [d.90.1.1] NADH OXIDASE
    2e-17  11%  1vkwA  [d.90.1.2] PUTATIVE NITROREDUCTASE
    2e-13  27%  2freA1 [d.90.1.1] NAD(P)H-FLAVIN OXIDOREDUCTASE A:1 -- 200
    2e-12  19%  2b67A1 [d.90.1.1] COG0778: NITROREDUCTASE A:1 -- 201
:274

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVSVEEALA
1vfrA           ----------------------------------------------------------------IIHDLE
1ywqA1          ----------------------------------------------------------------LKEAIV
2ifaA1          ---------------------------------------------------------------NFLDLQK
1bkjA           ------------------------------------------------------------------ETIL
1ds7A           ----------------------------------------------------------------IISVAL
1zchA1          ----------------------------------------------------------------VIKSLT
1noxA           ----------------------------------------------------------------AKTAAL
1vkwA           ----------------------------------------------------------------IFEAIE
2freA1          --------------------------------------------------------------YPVDPLFL
2b67A1          ------------------------------------------------------------------ELNK


                         .         .         *         .         .         .         .:140
query           NRRSVREFREEPLTLEELGQILWAAYGISETRYGLRTAPSAGAQYPLEVYVVVGEHGVKTGDGYLKPGVY
1vfrA           NRYTSKKYDPKKVSQEDLAVLLEAL----------RLSASSINSQPWKFIVIESDAAKQRMHNMHQFNQP
1ywqA1          NRRSIRKVTNDAITKERIEEVLKTA----------LHAPTSFNMQSGRMVVLMDG-EHEKFWDIVKETLR
2ifaA1          QRRSIYALGTVDLSKAELVALIQNAI---------KQAPSAFNSQTSRALVLFGQDSQDFWNKIAYSELE
1bkjA           AHRSIRKFTAVPITDEQRQTIIQAG----------LAASSSSMLQVVSIVRV------------------
1ds7A           KRHSTKAFDSKKLTPEQAEQIKTLL----------QYSPSSTNSQPWHFIVASTEEGKARVAKSAAVFNE
1zchA1          DHRSIRSYTDEPVAQEQLDQIIEAV----------QSAPSSINGQQVTVITVQDKE--------------
1noxA           KRRSIRRYRKDPVPEGLLREILEAAL----------RAPSAWNLQPWRIVVVRDP---------------
1vkwA           NRHSVRDFLERKXPERVKDDIENLL----------VKFITKKLDWKINLSSFPSY-IYAKAEKHFDELVE
2freA1          DRWSPRAFDGSPXPKEHLLTILDAA----------HWAPSASNHQPWRFVYAHKDSEDWP----------
2b67A1          KRHATKHFTDKLVDPKDVRTAIEIA----------TLAPSAHNSQPWKFVVV------REKNAELAKLAY


                         +         .         .         .         .         *         .:210
query           HYDPHSHTLTLKKTGDFREALYQAALEQIWVLKAPVSLIFTAVYSRTXXXXXXXXXXXXXPMDLGHAGQN
1vfrA           HIKACSHVILFANKLSYTRDDYDVVLSKAVAITEEQKEAAFASFKFELNCDENGEHKAWTKPQAYLALGN
1ywqA1          ARVPAENFE-------ATVERLKGFHAGVGTVLFFEDQATVEKMQENAPLYKDQFPFWSH-QGNAMLQHT
2ifaA1          KVTPAEAFAGTKAKLESFAAGVGTILLFEDQAVVRNLEENFPLYAENFQPWSE--------QAHGIALYA
1bkjA           ------------TDSEKRNELAQFAGNQAYVESAAEFLVFCIDYQRHATINPDVQADFTELVDSGIMAQN
1ds7A           RKMLDSHVVVFCAKTAMDDVWLKLVVDQEDADGRFATPEAKAANDKGRKFFAD--------MHRKDLHDD
1zchA1          ----------------RKKKISELAGGQPWIDQAPVFLLFCADFNRAKIALEDLHDFK---MEITNGLES
1noxA           ---------------ATKRALREAAFGQAHVEEAPVVLVLYADLEDALAHLDEVIHPGVQGERRKQAIQR
1vkwA           YGFQGEQIVLFLTAQGFGT--CWXARSPHPDVPYIIVFGYPRTRNFTRKRRPITSFLENDLEEIVKIVEX
2freA1          --------LFVELLXEGN---------QKWAKNASV-LLFVISRDHTISHEGEKKPSATHSFDAGAAWFS
2b67A1          GSSSAPVTIALFTDTDLKRARKIARVGGANNFSEEQLQYFXKNLPAEFARYSEQQVSDYLALNAGLVAXN


                         .         .         .         +         .         .         .:280
query           VYLQATALGLGTVAVGAFYDDQVAEILDLPDGETPLYIMPIGRPIYQYRLTEAELIRYIEKSRR
1vfrA           ALHTLARLNIDSTTMEGIDPELLSEIFADEKGYECHVALAIG-----YHHPSEDYNASLPKSRK
1ywqA1          VWMLLSAEGIGASLQHYIVDAEVKETWNIPAEWSLVGQMPFGEPNEQPFLPTEDVVKF------
2ifaA1          IWLALAEQNIGVQHYNPLVDAQVAEKYDLPTNWKXRAQIPFGSI--------------------
1bkjA           CLLAAESMGLGGVYIGGLRNSQVDELLGLPENSAVLFGMCLGHP--------------------
1ds7A           AEWMAKQVYLNVVPIEGFDAAILDAEFGLKKGYTSLVVVPVGHHSVESRLPQNITLTEV-----
1zchA1          VLVGAVSLGLGTVPIGAVNPQELIELLELPKYVFPLSGLVIGHPADRSRLPQEAVNHQ------
1noxA           AFAAMGQEARKAWAMLGFDPERVRAILGLPSRAAIPALVALGYPAEEGRLPLERVVLW------
1vkwA           TILAPSALNRQPWKIKYTGGELCISSERPVDLGIALSHAYLTAREIFKREPVIQ----------
2freA1          LAXQAHLLGYHAHGXGGIFKDRIVEKLDIPDGFKVEAGVAIGTL--------------------
2b67A1          LVLALTDQGIGSNIILGFDKSKVNEVLEIEDRFRPELLITVGYT--------------------