[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL64265.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2fnaA2.bssp"

## Summary of PDB Search
:360
    7e-55  44%  2fnaA2 [c.37.1.20] CONSERVED HYPOTHETICAL PROTEIN A:1 -- 283
:360

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLTLILGMRRVGKTSVVKAATYGKLRIYIDARYFEEKRY
2fnaA2          --------------------------------ITLVLGLRRTGKSSIIKIGILNLPYIYLDLRKFEERNY


                         .         .         *         .         .         .         .:140
query           ISYGDXXXXXXXXXXXXXXXXXXXGELLSKIRGVSVAGVDVKFEIGRNAPSFAEILEAFDQWAREQGERL
2fnaA2          ISYKDFLLELQKEINKLVKRLPSLLKALKNIQGIVIXGNEIKF----NRLSFANLLESFEQASKD---NV


                         +         .         .         .         .         *         .:210
query           VLIIDEAQELAKLRGRTLLPPLGYAYDNLRNISMVFTGSKAGLLLRFLRLEDPHSPLFGRYFEKIELGPF
2fnaA2          IIVLDEAQELVKLRGVNLLPALAYAYDNLKRIKFIXSGSEXGLLYDYLRVEDPESPLFGRAFSTVELKPF


                         .         .         .         +         .         .         .:280
query           SRELSVQFLTKGFEEAGVRVSRELIDRAVDELDGVVGWLAYFGLRAVKKPDSALEETLEYAARLAAAEFC
2fnaA2          SREEAIEFLRRGFQEADIDF--KDYEVVYEKIGGIPGWLTYFGFIYLKNLDFAINQTLEYAKKLILKEFE


                         .         *         .         .         .         .         +:350
query           NFVQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2fnaA2          NFLH------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxx
2fnaA2          ----------