[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL64389.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1clcA1.bssp"
#ERROR : Can't open dsspfile "2afaA1.bssp"
#ERROR : Can't open dsspfile "1fp3A.bssp"
#ERROR : Can't open dsspfile "1hcuA.bssp"
#ERROR : Can't open dsspfile "1j5sA.bssp"
#ERROR : Can't open dsspfile "2dlxA1.bssp"
#ERROR : Can't open dsspfile "1ovnA2.bssp"
#ERROR : Can't open dsspfile "1nc5A.bssp"
#ERROR : Can't open dsspfile "1uc7A.bssp"
#ERROR : Can't open dsspfile "1senA.bssp"
#ERROR : Can't open dsspfile "1qgvA.bssp"
#ERROR : Can't open dsspfile "1a8lA1.bssp"
#ERROR : Can't open dsspfile "1g7eA.bssp"
#ERROR : Can't open dsspfile "1un2A.bssp"
#ERROR : Can't open dsspfile "1wouA.bssp"
#ERROR : Can't open dsspfile "2b5eA1.bssp"
#ERROR : Can't open dsspfile "2b5eA3.bssp"
#ERROR : Can't open dsspfile "1a8lA2.bssp"
#ERROR : Can't open dsspfile "1eejA1.bssp"
#ERROR : Can't open dsspfile "2es7A1.bssp"
#ERROR : Can't open dsspfile "1bjxA.bssp"
#ERROR : Can't open dsspfile "2b5eA4.bssp"
#ERROR : Can't open dsspfile "1a0rP.bssp"
#ERROR : Can't open dsspfile "1rq5A1.bssp"
#ERROR : Can't open dsspfile "2fy6A1.bssp"
#ERROR : Can't open dsspfile "1r26A.bssp"
#ERROR : Can't open dsspfile "2g02A1.bssp"
#ERROR : Can't open dsspfile "1hyuA4.bssp"
#ERROR : Can't open dsspfile "1dl2A.bssp"
#ERROR : Can't open dsspfile "1lu4A.bssp"

## Summary of PDB Search
:667
    1e-17  10%  1clcA1 [a.102.1.2] ENDOGLUCANASE CELD EC: 3.2.1.4 A:135 -- 575
    1e-12  18%  2afaA1 [a.102.1.3] NAG ISOMERASE A:4 -- 415
    4e-11  13%  1fp3A  [a.102.1.3] N-ACYL-D-GLUCOSAMINE 2-EPIMERASE
    5e-11  10%  1hcuA  [a.102.2.1] ALPHA-1,2-MANNOSIDASE
    2e-10   9%  1j5sA  [c.1.9.8] URONATE ISOMERASE
    8e-10  14%  2dlxA1 [c.47.1.24] UBX DOMAIN-CONTAINING PROTEIN 7 A:1 -- 147
    2e-09   6%  1ovnA2 [c.47.1.7] WINDBEUTEL A:24 -- 145
    2e-08  10%  1nc5A  [a.102.1.6] HYPOTHETICAL PROTEIN YTER
    2e-08  18%  1uc7A  [c.47.1.1] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBD
    2e-07  15%  1senA  [c.47.1.1] THIOREDOXIN-LIKE PROTEIN P19
    3e-07  18%  1qgvA  [c.47.1.8] SPLICEOSOMAL PROTEIN U5-15KD
    4e-07  13%  1a8lA1 [c.47.1.2] PROTEIN DISULFIDE OXIDOREDUCTASE A:1 -- 119
    8e-07   7%  1g7eA  [c.47.1.7] ENDOPLASMIC RETICULUM PROTEIN ERP29
    9e-07   6%  1un2A  [c.47.1.13] THIOL-DISULFIDE INTERCHANGE PROTEIN
    1e-06   8%  1wouA  [c.47.1.16] THIOREDOXIN -RELATED PROTEIN, 14 KDA
    3e-06  19%  2b5eA1 [c.47.1.2] PROTEIN DISULFIDE-ISOMERASE A:365 -- 504
    8e-05   8%  2b5eA3 [c.47.1.2] PROTEIN DISULFIDE-ISOMERASE A:240 -- 364
    1e-04   7%  1a8lA2 [c.47.1.2] PROTEIN DISULFIDE OXIDOREDUCTASE A:120 -- 226
    2e-04  16%  1eejA1 [c.47.1.9] THIOL:DISULFIDE INTERCHANGE PROTEIN A:61 -- 216
    2e-04   3%  2es7A1 [c.47.1.20] PUTATIVE THIOL-DISULFIDE ISOMERASE AND A:7 --
    4e-04   7%  1bjxA  [c.47.1.2] PROTEIN DISULFIDE ISOMERASE
    5e-04  18%  2b5eA4 [c.47.1.2] PROTEIN DISULFIDE-ISOMERASE A:23 -- 141
    5e-04  12%  1a0rP  [c.47.1.6] PHOSDUCIN
    6e-04  26%  1rq5A1 [a.102.1.2] CELLOBIOHYDROLASE A:306 -- 815
    6e-04  16%  2fy6A1 [c.47.1.10] PEPTIDE METHIONINE SULFOXIDE REDUCTASE MSRA/MSRB
    7e-04  31%  1r26A  [c.47.1.1] THIOREDOXIN
    7e-04  14%  2g02A1 [a.102.6.1] NISIN BIOSYNTHESIS PROTEIN NISC A:7 -- 415
    7e-04  11%  1hyuA4 [c.47.1.2] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F A:103
    7e-04  17%  1dl2A  [a.102.2.1] CLASS I ALPHA-1,2-MANNOSIDASE
    8e-04  14%  1lu4A  [c.47.1.10] SOLUBLE SECRETED ANTIGEN MPT53
:667

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxLSSSSSPFVLEGLKSRVKWWGWCKEAFEAAEREDKPVLVDVGAVWCHWCHVMDERTYNDEEVA
1clcA1          ----------------------------------------------------------------------
2afaA1          ----------------------------------------------------------------------
1fp3A           ----------------------------------------------------------------------
1hcuA           ----------------------------------------------------------------------
1j5sA           -----------------------SLFKTLGPDSGGDISTNFLRYFLNEFDGKLKIVLYVLDPTHLPT--I
2dlxA1          -------SGIDKKLTTLADLFRPLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVK
1ovnA2          -------------------------------LSFEKTVERFPYSVVKFDIAYPYGEKHEAFTAFSKSAHK
1nc5A           ----------------------------------------------------------------------
1uc7A           -----------------------TQIKTVDELNQALVEAKGKPVMLDLYADWCVACKEFEKYTFSDPQVQ
1senA           ------------------------------EDGKKEAAASGLPLMVIIHKSWCGACKALKPKF--AESTE
1qgvA           ------------------------------------LSEEDRVVVIRFGHDWDPTCMKMD---EVLYSIA
1a8lA1          ------------------------------KEEFFSKMVNPVKLIVFVRKDHCQYCDQLKQLVQELSELT
1g7eA           ------------------------------TVTFYKPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSD
1un2A           -----------------------SEYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVK
1wouA           ------------------------------FEEFHREQHNGKTIFAYFTGGGKSWCPDCVQAEPVVREGL
2b5eA1          ------------------------------KNHDEIVNDPKKDVLVLYYAPWCGHCKRLAP--TYQELAD
2b5eA3          ------------------------------------QYVESGLPLGYLFYNDEEELEEYKPDARKFGRHA
1a8lA2          ------------------------------ETKQAIRNIDQDVRILVFVTPTCPYCPLAVR--MAHKFAI
1eejA1          -------------------------------EMIVYKAPQEKHVITVFTDITCGYC--HKLHEQMADYNA
2es7A1          ------------------------------TRGWQPVEASVGDGVILLSSDPRRSDNPV-----------
1bjxA           ------------------------------GAAAESLVESSEVAVIGFFKDVESDSAKQ-----------
2b5eA4          ------------------------AVVKLATDSFNEYIQSHDLVLAEFFAPWCGHCKNMAP--EYVKAAE
1a0rP           -------------------------------LETIEKEQKITTIVVHIYEDGIKGCDALN--SSLICLAA
1rq5A1          ----------------------------------------------------------------------
2fy6A1          -------------------------------RPASVYLKKDKPTLIKFWASWCPLCLSELGQTEKWAQDA
1r26A           ------------------------------VEQFRNIMSEDILTVAWFTAVWCGPCKTI-----------
2g02A1          ----------------------------------------------------------------------
1hyuA4          -------------------------------QSLLERDIDGDFEFETYYSLSCHNCPDV-----------
1dl2A           ----------------------------------------------------------------------
1lu4A           -------------------------------APFDGASLQGKPAVLWFWTPWCPFCNAEAPSLSQVAAAN


                         .         .         *         .         .         .         .:140
query           EFINKHFIPXXXXXXXXXXXXXXLQEAAQLISGQSGWPLTVFMTPKGQVIWAATYLPPRREMGLPGMLEV
1clcA1          ----------------------------------------------------------------------
2afaA1          ----------------------------------------------------------------------
1fp3A           ----------------------------------------------------------------------
1hcuA           ----------------------------------------------------------------------
1j5sA           STIARAFPNVYVGAPWWFNDSPFGMEHLKYLASVDLLYNLAGMVTDSRKL--LSFGS-----RTEMFRRV
2dlxA1          NIIREHFIFWQVYHDSEEGQRYIQFY------KLGDFPYVSILDPRTGQKLVEW-----HQLDVSSFLDQ
1ovnA2          ATKDLLIATVGVKDYGELENK---ALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVDV---TLDNLKAF
1nc5A           ----------------------------------------------------------------------
1uc7A           KALADTVLLQANVTANDAQDVALLKHL-----NVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAHLR-
1senA           ISELSHNFVMVNLEDEEEPKDEDFSP------DGGYIPRILFLDPSGKVHIINENGNPSYKYFYVSAEQV
1qgvA           EKVKNFAVIYLVDITEVPDFNKMY--------ELYDPCTVMFFFRNKHIMIDLGINWA--MEDKQEMVDI
1a8lA1          DKLSYEIVD----------FDTPEGKELAKRYRIDRAPATTITQDGKDFGVRYFG-----LPAGHEFAAF
1g7eA           DLLVAEVGISDYGDKLNM------ELSEKYKLDKESYP-VFYLFRDGDFENPVPY------SGAVKVGAI
1un2A           KKLPEGVKMTKYHVNFMGGDLGKD--------LTQAWAVAMAL-GVEDKVTVPLFEGVQKT---------
1wouA           KHISEGCVFIYCQVGEKPYWKDPNNDFRKNL-KVTAVPTLLKYGTPQKLVESECLQAN------------
2b5eA1          TYANATSDVLIAKLDHTENDVRGV--------VIEGYP-TIVLYPGGKKSESVVY---QGSRSLDSLFDF
2b5eA3          GNLNMKEQFPLFAIHDM-------TEDLKYGLPQLSEEAFDELSDKIV--------LESKAIE-SLVKDF
1a8lA2          ENTKAGKG--------------------------------------------------------------
1eejA1          LGITVRYL--------------------------------------------------------------
2es7A1          ----------------------------------------------------------------------
1bjxA           ----------------------------------------------------------------------
2b5eA4          TLVEKNI---------------------------------------------------------------
1a0rP           EYPMVKFCKIKASNT---------GAGDRF--SSDVLP-TLLVYKGGELL--SNFISVTEQLAEEFFTGD
1rq5A1          ----------------------------------------------------------------------
2fy6A1          KFSSANLITVASPGFLHEKKDGDFQKWYAGLNNISVYPSWALIGKDGDVQRIVKGSINEAQ-----ALAL
1r26A           ----------------------------------------------------------------------
2g02A1          ----------------------------------------------------------------------
1hyuA4          ----------------------------------------------------------------------
1dl2A           ----------------------------------------------------------------------
1lu4A           PAVTFVGIATRADVGAMQSFVSKYNLNFTNLNNVPWQPAFVFYRADGTSTFVNNPTAAMSQDELSGRVAA


                         +         .         .         .         .         *         .:210
query           LEAVLRAYREKRGEVEKFHEDLARELxxxxxxxxxxxxxxxxxxxxxxLAASFDEEYGGFGGAPKFPPIT
1clcA1          ----------------------------------------------------------------------
2afaA1          ----------------------------------------------------------------------
1fp3A           ------------------------------------------------LEHSHDREHGGLGRDGRVYDVW
1hcuA           ----------------------------------------------------------------------
1j5sA           LSNVVGEMVEKGQIPIKEARELVKHV--------------------------------------------
2dlxA1          VTGFLGEHGQ------------------------------------------------------------
1ovnA2          VSANTPLY--------------------------------------------------------------
1nc5A           ----------------------------------------------------------------------
1uc7A           ----------------------------------------------------------------------
1senA           VQGMKEAQERLTGD--------------------------------------------------------
1qgvA           IETVYRGARKGRGLVV------------------------------------------------------
1a8lA1          LEDIVDVSREE-----------------------------------------------------------
1g7eA           QRWLKGQGVY------------------------------------------------------------
1un2A           ----------------------------------------------------------------------
1wouA           ----------------------------------------------------------------------
2b5eA1          IKENGHFDVDGKALYEEAQEKAAEE---------------------------------------------
2b5eA3          LKGDASP---------------------------------------------------------------
1a8lA2          ----------------------------------------------------------------------
1eejA1          ----------------------------------------------------------------------
2es7A1          ----------------------------------------------------------------------
1bjxA           ----------------------------------------------------------------------
2b5eA4          ----------------------------------------------------------------------
1a0rP           VESFLNEY--------------------------------------------------------------
1rq5A1          ----------------------------------------------------------------------
2fy6A1          IRDPNAD---------------------------------------------------------------
1r26A           ----------------------------------------------------------------------
2g02A1          ----------------------------------------------------------------------
1hyuA4          ----------------------------------------------------------------------
1dl2A           ----------------------------------------------------------------------
1lu4A           L---------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QLELLMMRHFYDGVGIYGKMAERTLDAMALGGVYDQLLGGFFRYSTDRSWLIPHYEKLLIDNAELLAVYT
1clcA1          ----------------------------------------------------------VYEDAFKTAMLG
2afaA1          ----------------LLEDAKGLFHATIRDAWAPDGADGFV-YSVDWDGKPIVRERVRWPIVEAXGTAY
1fp3A           MYCRLYRKLERFHRPELLDAAKAGGEFLLRHARVAPP-EKKCAFVLTRDGRPVKVQRSIFSECFYTMAMN
1hcuA           ----------------------------------------------------------------------
1j5sA           ----------------------------------------------------------------------
2dlxA1          ----------------------------------------------------------------------
1ovnA2          ----------------------------------------------------------------------
1nc5A           ---------------------------------------TIMNTYTVEEL--PPANRWHYHQGVFLCGVL
1uc7A           ----------------------------------------------------------------------
1senA           ----------------------------------------------------------------------
1qgvA           ----------------------------------------------------------------------
1a8lA1          ----------------------------------------------------------------------
1g7eA           ----------------------------------------------------------------------
1un2A           ----------------------------------------------------------------------
1wouA           ----------------------------------------------------------------------
2b5eA1          ----------------------------------------------------------------------
2b5eA3          ----------------------------------------------------------------------
1a8lA2          ----------------------------------------------------------------------
1eejA1          ----------------------------------------------------------------------
2es7A1          ----------------------------------------------------------------------
1bjxA           ----------------------------------------------------------------------
2b5eA4          ----------------------------------------------------------------------
1a0rP           ----------------------------------------------------------------------
1rq5A1          ----------------------------------------------------------------------
2fy6A1          ----------------------------------------------------------------------
1r26A           ----------------------------------------------------------------------
2g02A1          ----------------------------------------------------------------------
1hyuA4          ----------------------------------------------------------------------
1dl2A           ----------------------------------------------------------------------
1lu4A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KAYRQFGKALYKRTAEGIVKWLDEFMRAPEGGYYASQDADVDGEEGGYYRWSXXXXXXXXXXXYPVASKH
1clcA1          MYLLRCGTSVSATYNGIHYSHGPCHTKDSTKGWHDAGDYNKYVVNAGITVGSMFLAWEHFKDQLEIPEKN
2afaA1          ALYTLTDDSQYEEWYQKWWDYCIKYLXDYEGSWWQELDADNKVTTGKQ----------------------
1fp3A           ELWRVTAEARYQSEAVDMMDQIVHWVREDPSGLGRPQLPGAVASESMAVPM-------------------
1hcuA           ----------------------------------------------------------------------
1j5sA           ----------------------------------------------------------------------
2dlxA1          ----------------------------------------------------------------------
1ovnA2          ----------------------------------------------------------------------
1nc5A           RLWEATGEKRYFEYAKAYADLLIDDNGNLLFRRDELDAIQAGLILFPLYEQ-------------------
1uc7A           ----------------------------------------------------------------------
1senA           ----------------------------------------------------------------------
1qgvA           ----------------------------------------------------------------------
1a8lA1          ----------------------------------------------------------------------
1g7eA           ----------------------------------------------------------------------
1un2A           ----------------------------------------------------------------------
1wouA           ----------------------------------------------------------------------
2b5eA1          ----------------------------------------------------------------------
2b5eA3          ----------------------------------------------------------------------
1a8lA2          ----------------------------------------------------------------------
1eejA1          ----------------------------------------------------------------------
2es7A1          ----------------------------------------------------------------------
1bjxA           ----------------------------------------------------------------------
2b5eA4          ----------------------------------------------------------------------
1a0rP           ----------------------------------------------------------------------
1rq5A1          ----------------------------------------------------------------------
2fy6A1          ----------------------------------------------------------------------
1r26A           ----------------------------------------------------------------------
2g02A1          ----------------------------------------------------------------------
1hyuA4          ----------------------------------------------------------------------
1dl2A           ----------------------------------------------------------------------
1lu4A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FGLEEYPWPEGKATLRVARPLEGPEAERIYQILIEARRKRKPPFTDTTVYVGWSCAMAYAELLASRLASV
1clcA1          NSIPDFLDELKYEIDWILTMQYPDGSGRVAHGGFIMPENEHDERFFVPWSSAATADFVAMTAMAARIQYA
2afaA1          ----------------------------------------------------------------------
1fp3A           ----------------------------------------------------------------------
1hcuA           --------------------------NAYHHFAFPHDDLHPVSNSFDDERNGWGSSAIDGLDTAILMGDA
1j5sA           ----------------------------------------------------------------------
2dlxA1          ----------------------------------------------------------------------
1ovnA2          ----------------------------------------------------------------------
1nc5A           ----------------------------------------------------------------------
1uc7A           ----------------------------------------------------------------------
1senA           ----------------------------------------------------------------------
1qgvA           ----------------------------------------------------------------------
1a8lA1          ----------------------------------------------------------------------
1g7eA           ----------------------------------------------------------------------
1un2A           ----------------------------------------------------------------------
1wouA           ----------------------------------------------------------------------
2b5eA1          ----------------------------------------------------------------------
2b5eA3          ----------------------------------------------------------------------
1a8lA2          ----------------------------------------------------------------------
1eejA1          ----------------------------------------------------------------------
2es7A1          ----------------------------------------------------------------------
1bjxA           ----------------------------------------------------------------------
2b5eA4          ----------------------------------------------------------------------
1a0rP           ----------------------------------------------------------------------
1rq5A1          ----------------------------------------------------------------------
2fy6A1          ----------------------------------------------------------------------
1r26A           ----------------------------------------------------------------------
2g02A1          ----------------------------------------------------------------------
1hyuA4          ----------------------------------------------------------------------
1dl2A           ----------------------------------------------------------------------
1lu4A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GNKYHAVRTLERFGVEXXXXXXXXXXXXXXXXXXIAALEDYAYCILAWIEGYSHTAKLEFLKVAESAGEI
1clcA1          EKCINAAKVSYEFLKN--NPANVFANQSGFSTGEYATVSDADDRLWAAAEMWETLGDEEYLRDFENLGMF
2afaA1          -------------------------------------GYQHFFALLGAASAVTTGHP-EARKLLDYTIEV
1fp3A           ----------------------------------------------------------------------
1hcuA           DIVNTILQYVPQINFTTTAVANQGSSVFETNIRYLGGLSAYDLLRGPFSSLANQTLVNSLLRQAQTLANG
1j5sA           ----------------------------------------------------------------------
2dlxA1          ----------------------------------------------------------------------
1ovnA2          ----------------------------------------------------------------------
1nc5A           ----------------------------------------------------------------------
1uc7A           ----------------------------------------------------------------------
1senA           ----------------------------------------------------------------------
1qgvA           ----------------------------------------------------------------------
1a8lA1          ----------------------------------------------------------------------
1g7eA           ----------------------------------------------------------------------
1un2A           ----------------------------------------------------------------------
1wouA           ----------------------------------------------------------------------
2b5eA1          ----------------------------------------------------------------------
2b5eA3          ----------------------------------------------------------------------
1a8lA2          ----------------------------------------------------------------------
1eejA1          ----------------------------------------------------------------------
2es7A1          ----------------------------------------------------------------------
1bjxA           ----------------------------------------------------------------------
2b5eA4          ----------------------------------------------------------------------
1a0rP           ----------------------------------------------------------------------
1rq5A1          ----------------------------------------------------------------------
2fy6A1          ----------------------------------------------------------------------
1r26A           ----------------------------------------------------------------------
2g02A1          ----------------------------------------------------------------------
1hyuA4          ----------------------------------------------------------------------
1dl2A           ----------------------------------------------HLSDVLEVGNKTVYLNKAIDLGDR
1lu4A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           LLAKFLEEGGFKDVETVDEIIPTPNYPALDTPNFSGNAVAAIALATLSEVTGDAKYKEAAYRAVSALYGK
1clcA1          TYLLSERPGKNPALVQSIKDSLLSTADSIVRTCNGTVVRQTMILQVANKISPNNDYVNAALDAISHVFGR
2afaA1          IEKYFWSEEEQXCLESWDEAFSQTE----DYRGGNANXHAVEAFLIVYDVTHDKKWLDRALRIASVIIHD
1fp3A           ----------------------------------------------------------------------
1hcuA           LKVAFTTPSGVPDPTVFFNPTVRRSGA--SSNNVAEIGSLVLEWTRLSDLTGNPQYAQLAQKGESYLLNP
1j5sA           ----------------------------------------------------------------------
2dlxA1          ----------------------------------------------------------------------
1ovnA2          ----------------------------------------------------------------------
1nc5A           ----------------------------------------------------------------------
1uc7A           ----------------------------------------------------------------------
1senA           ----------------------------------------------------------------------
1qgvA           ----------------------------------------------------------------------
1a8lA1          ----------------------------------------------------------------------
1g7eA           ----------------------------------------------------------------------
1un2A           ----------------------------------------------------------------------
1wouA           ----------------------------------------------------------------------
2b5eA1          ----------------------------------------------------------------------
2b5eA3          ----------------------------------------------------------------------
1a8lA2          ----------------------------------------------------------------------
1eejA1          ----------------------------------------------------------------------
2es7A1          ----------------------------------------------------------------------
1bjxA           ----------------------------------------------------------------------
2b5eA4          ----------------------------------------------------------------------
1a0rP           ----------------------------------------------------------------------
1rq5A1          --------------------------------SNSFILNQMIVMGYAYDFTGDSKYLDGMFDGISYLLGR
2fy6A1          ----------------------------------------------------------------------
1r26A           ----------------------------------------------------------------------
2g02A1          ---------IKRNVEKIIAQWDETRKDFGELTLSTGLPGIILMLAELKNKDNSKIYQKKIDNYIEYIVSK
1hyuA4          ----------------------------------------------------------------------
1dl2A           LALAFLQTGIPYSSINLHSGQAVKNHADGGASSTAEFTTLQMEFKYLAYLTGNRTYWE------------
1lu4A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           MERVGPAASGLWIALDLLTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1clcA1          ----------------------------------------------------------------------
2afaA1          V---------------------------------------------------------------------
1fp3A           ----------------------------------------------------------------------
1hcuA           KGSPEAWPGLIGTFVSTSN---------------------------------------------------
1j5sA           ----------------------------------------------------------------------
2dlxA1          ----------------------------------------------------------------------
1ovnA2          ----------------------------------------------------------------------
1nc5A           ----------------------------------------------------------------------
1uc7A           ----------------------------------------------------------------------
1senA           ----------------------------------------------------------------------
1qgvA           ----------------------------------------------------------------------
1a8lA1          ----------------------------------------------------------------------
1g7eA           ----------------------------------------------------------------------
1un2A           ----------------------------------------------------------------------
1wouA           ----------------------------------------------------------------------
2b5eA1          ----------------------------------------------------------------------
2b5eA3          ----------------------------------------------------------------------
1a8lA2          ----------------------------------------------------------------------
1eejA1          ----------------------------------------------------------------------
2es7A1          ----------------------------------------------------------------------
1bjxA           ----------------------------------------------------------------------
2b5eA4          ----------------------------------------------------------------------
1a0rP           ----------------------------------------------------------------------
1rq5A1          ----------------------------------------------------------------------
2fy6A1          ----------------------------------------------------------------------
1r26A           ----------------------------------------------------------------------
2g02A1          LSTYGLLTGSL-----------------------------------------------------------
1hyuA4          ----------------------------------------------------------------------
1dl2A           ----------------------------------------------------------------------
1lu4A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1clcA1          -------------------------------------
2afaA1          -------------------------------------
1fp3A           -------------------------------------
1hcuA           -------------------------------------
1j5sA           -------------------------------------
2dlxA1          -------------------------------------
1ovnA2          -------------------------------------
1nc5A           -------------------------------------
1uc7A           -------------------------------------
1senA           -------------------------------------
1qgvA           -------------------------------------
1a8lA1          -------------------------------------
1g7eA           -------------------------------------
1un2A           -------------------------------------
1wouA           -------------------------------------
2b5eA1          -------------------------------------
2b5eA3          -------------------------------------
1a8lA2          -------------------------------------
1eejA1          -------------------------------------
2es7A1          -------------------------------------
1bjxA           -------------------------------------
2b5eA4          -------------------------------------
1a0rP           -------------------------------------
1rq5A1          -------------------------------------
2fy6A1          -------------------------------------
1r26A           -------------------------------------
2g02A1          -------------------------------------
1hyuA4          -------------------------------------
1dl2A           -------------------------------------
1lu4A           -------------------------------------