[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL64489.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1h0hA2.bssp"
#ERROR : Can't open dsspfile "1ogyA2.bssp"
#ERROR : Can't open dsspfile "1dmrA2.bssp"
#ERROR : Can't open dsspfile "1aa6A2.bssp"
#ERROR : Can't open dsspfile "1g8jA2.bssp"
#ERROR : Can't open dsspfile "1ti2A2.bssp"
#ERROR : Can't open dsspfile "1q16A2.bssp"
#ERROR : Can't open dsspfile "1a8eA.bssp"
#ERROR : Can't open dsspfile "1gqiA1.bssp"
#ERROR : Can't open dsspfile "1hq0A.bssp"
#ERROR : Can't open dsspfile "2b20A1.bssp"
#ERROR : Can't open dsspfile "1ozfA1.bssp"
#ERROR : Can't open dsspfile "2fug32.bssp"
#ERROR : Can't open dsspfile "1ogyA1.bssp"
#ERROR : Can't open dsspfile "1g8jA1.bssp"
#ERROR : Can't open dsspfile "2c31A1.bssp"
#ERROR : Can't open dsspfile "1q16A1.bssp"
#ERROR : Can't open dsspfile "1oz4A1.bssp"
#ERROR : Can't open dsspfile "1aa6A1.bssp"
#ERROR : Can't open dsspfile "1ti2A1.bssp"
#ERROR : Can't open dsspfile "1upaA1.bssp"
#ERROR : Can't open dsspfile "1h0hA1.bssp"
#ERROR : Can't open dsspfile "1dmrA1.bssp"
#ERROR : Can't open dsspfile "1v37A.bssp"
#ERROR : Can't open dsspfile "1cz4A1.bssp"
#ERROR : Can't open dsspfile "2fug31.bssp"

## Summary of PDB Search
:816
    2e-87  15%  1h0hA2 [c.81.1.1] FORMATE DEHYDROGENASE (LARGE SUBUNIT) A:1 -- 812
    2e-73  18%  1ogyA2 [c.81.1.1] PERIPLASMIC NITRATE REDUCTASE A:12 -- 681
    5e-69  23%  1dmrA2 [c.81.1.1] DMSO REDUCTASE A:3 -- 625
    1e-56  18%  1aa6A2 [c.81.1.1] FORMATE DEHYDROGENASE H A:1 -- 564
    1e-51  14%  1g8jA2 [c.81.1.1] ARSENITE OXIDASE A:6 -- 682
    1e-49  16%  1ti2A2 [c.81.1.1] PYROGALLOL HYDROXYTRANSFERASE LARGE SUBUNIT A:1
    1e-35  15%  1q16A2 [c.81.1.1] RESPIRATORY NITRATE REDUCTASE 1 ALPHA CHAIN A:1
    6e-23   6%  1a8eA  [c.94.1.2] SERUM TRANSFERRIN
    6e-22  10%  1gqiA1 [c.1.8.10] ALPHA-GLUCURONIDASE A:152 -- 712
    4e-19   9%  1hq0A  [d.194.1.1] CYTOTOXIC NECROTIZING FACTOR 1
    3e-16   9%  2b20A1 [b.1.18.20] ENTEROCHELIN ESTERASE A:3 -- 150
    4e-16  11%  1ozfA1 [c.31.1.3] ACETOLACTATE SYNTHASE, CATABOLIC A:188 -- 366
    5e-16  23%  2fug32 [c.81.1.1] NADH-QUINONE OXIDOREDUCTASE CHAIN 3 3:247 -- 685
    5e-15  22%  1ogyA1 [b.52.2.2] PERIPLASMIC NITRATE REDUCTASE A:682 -- 801
    9e-15  22%  1g8jA1 [b.52.2.2] ARSENITE OXIDASE A:683 -- 825
    3e-14  13%  2c31A1 [c.31.1.3] OXALYL-COA DECARBOXYLASE A:195 -- 369
    3e-14  21%  1q16A1 [b.52.2.2] RESPIRATORY NITRATE REDUCTASE 1 ALPHA CHAIN
    5e-14  19%  1oz4A1 [b.52.2.3] TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE A:27 --
    1e-12  22%  1aa6A1 [b.52.2.2] FORMATE DEHYDROGENASE H A:565 -- 715
    2e-11  21%  1ti2A1 [b.52.2.2] PYROGALLOL HYDROXYTRANSFERASE LARGE SUBUNIT A:729
    4e-11  12%  1upaA1 [c.31.1.3] CARBOXYETHYLARGININE SYNTHASE A:198 -- 374
    1e-10  23%  1h0hA1 [b.52.2.2] FORMATE DEHYDROGENASE (LARGE SUBUNIT) A:813 --
    7e-08  46%  1dmrA1 [b.52.2.2] DMSO REDUCTASE A:626 -- 781
    2e-05  16%  1v37A  [c.60.1.1] PHOSPHOGLYCERATE MUTASE
    3e-05  20%  1cz4A1 [b.52.2.3] VCP-LIKE ATPASE A:1 -- 91
    1e-04  28%  2fug31 [b.52.2.2] NADH-QUINONE OXIDOREDUCTASE CHAIN 3 3:686 -- 767
:816

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxLSRREFGKXXXXXXXXXXXXXXXKPLFEAKSAQVTQTGVEAVPITXXXXXXXXXLFFVRNGQRMYLL
1h0hA2          ------------------------------------------------------------KKTNRAINVE
1ogyA2          ------------------------------------------------------------TRDGQVVATH
1dmrA2          ------------------------------------------------------------VENGRATAFT
1aa6A2          ---------------------------------------------------------NLVVDNGKIVRAE
1g8jA2          -----------------------------------------------------------GARYDIMVVPD
1ti2A2          ------------------------------------------------------------VKDGKIIRMT
1q16A2          ---LDRFRYFKQKGETFADGHGQLLNTNRDWEDGYRQRWQHDKIVRHGVNCTGSCSWKIYVKNGLVTWET
1a8eA           ------------------------------------------------------------IAANEADAVT
1gqiA1          ----------------------------------------------------------------------
1hq0A           ----------------------------------------------------------------------
2b20A1          ----------------------------------------------------------------------
1ozfA1          ----------------------------------------------------------------------
2fug32          ------------------------------------------------------------TRSGELLRIR
1ogyA1          ----------------------------------------------------------------------
1g8jA1          ----------------------------------------------------------------------
2c31A1          ----------------------------------------------------------------------
1q16A1          ----------------------------------------------------------------------
1oz4A1          ----------------------------------------------------------------------
1aa6A1          ----------------------------------------------------------------------
1ti2A1          ----------------------------------------------------------------------
1upaA1          ----------------------------------------------------------------------
1h0hA1          ----------------------------------------------------------------------
1dmrA1          ----------------------------------------------------------------------
1v37A           ---------------------------------------------------------LWLVRHGETLWNR
1cz4A1          ----------------------------------------------------------------------
2fug31          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PNPKHPQPGMCFRPASALQLWNHPLRLKKPLKRVGERGEGKFQEVDWETALNEIAQRLREIVQRYGPESV
1h0hA2          GDPDHPEGSLCAKGASTWQLAENERRPANPLYRA--PGSDQWEEKSWDWMLDTIAERVAKTREATFVTKN
1ogyA2          GDTQAERGLNCVKGYFLSKIMYGEDRLTTPLLRMKYHKEGEFAPVSWDEAFDVMAAQAKLVLKEKAPEAV
1dmrA2          PWEKDPHP--SPMLAGVLDSIYSPTRIKYPMVRRETRGNGDFVRVSWDQALDLVAAEVKRVEETYGPEGV
1aa6A2          AAQGKTNQGLCLKGYYGWDFINDTQILTPRLKTIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAI
1g8jA2          KACVVNSGLSSTRGGKMASYMYTPTGDGKERLSAPRYAADEWVDTTWDHAMALYAGLIKKTLDSDGPQGV
1ti2A2          PMDFDDAVDAAPYTAGFKSMIYSDLRIPYPMKRKSQDPWSDYERISWDEATDIVVAEINRIKHAYGPSAI
1q16A2          QQTDYPEPRGCPRGASYSWYLYSANRLKYPMMRKRLRGRGGFVRSSWQEVNELIAASNVYTIKNYGPDRV
1a8eA           LDAGLVYDAYPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDS-GFQMNQLRGKKSCHTGLGRSAGWNIPI
1gqiA1          ----------HTGMAGVINPGTDRNWTGHPF---VQSSWYAFGRMAWDHQISAATAADEWLRMTFSNQPA
1hq0A           ----------------------------------------------------------------------
2b20A1          ----------------------------------------------------------------------
1ozfA1          ------------------------------------------MGAAPDDAIDQVAKLIAQAKNPIFLLGL
2fug32          AREVPEEIWICDAGRFGHE-WADQNRLKTPLVR----KEGRLVEATWEEAFLALKEGLKEA----RGEEV
1ogyA1          ----------------------------------------------------------------------
1g8jA1          ----------------------------------------------------------------------
2c31A1          --------------------------------------------IPAEDAIARAADLIKNAKRPVIMLGK
1q16A1          ----------------------------------------------------------------------
1oz4A1          ----------------------------------------------------------------------
1aa6A1          ----------------------------------------------------------------------
1ti2A1          ----------------------------------------------------------------------
1upaA1          --------------------------------------------VGAAAIRSGAVPAIRALAERLN----
1h0hA1          ----------------------------------------------------------------------
1dmrA1          ----------------------------------------------------------------------
1v37A           EGRLLGWTDLPLTAEGEAQARRLKGALPSDLLRARRTAELAGFSPRLYPELREIHALWETLDPRYKEALL
1cz4A1          ----------------------------------------------------------------------
2fug31          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AFTRHDHMSWILPFIASVIGTPNIISHEGTCHAASTAVRKFVLGASGPSSVDPDYENANYILLIGRNLDA
1h0hA2          AKGQVVNRCDGIASVGSSLGLFYIEHQARIXHSATVAALAESYGRGAMTNHWIDLKNSDVILMMGSNPAE
1ogyA2          GMFGSGQWTAASKLMRAGFRSNNLDPNARHCMASAATAFMRTFGMDEPMGCYDDFEAADAFVLWGSNMAE
1dmrA2          FGGSYGWKSPGRLHNCYVNGAGDYSTGAAQVIMPHVVGTLEVYEQ--QTAWPVLAENTEVMVFWAADPIK
1aa6A2          QTTGNETNYVMQKFARAVIGTNNVDCCARVXHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPAD
1g8jA2          FFSCGFENTWGTGLMFSAIQTPMVRIHNRPAYNSECHA-TREMGIGELNNAYEDAQLADVIWSIGNNPYE
1ti2A2          LSTPSSHHMWGNVGYRHSMGFTYADHHWGGMHMWGFS---WRLGNPEQYDLLEGLKHAEMIVFWSSDPET
1q16A2          AGFSPIPAMASGARYLSLIGGTCLSFYDWYCDLP--PASPQTWGEQTDVPESADWYNSSYIIAWGSNVPQ
1a8eA           GLLYCDLPELEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKC-LKDGAGDVAFV
1gqiA1          FIEPVKQMMQGDHYGPAPWTDDLPYYHRASKTGIGFNRTKTGSNALAPEPIAKAWGDLNDLILWFHHLSW
1hq0A           ----------------------------------------------------------------------
2b20A1          ----------------------------------------------------------------------
1ozfA1          MASQPENSKALRRLLIPVTSTYQAAGAVNQDNFSRFAGR---VGLFNNQAGDRLLQLADLVICIGYSPV-
2fug32          GLYLAHDATLLASELAKALKTPHLDFQGRTAAPASL---------FPPASLE-DLLQADFALVLGRLSEF
1ogyA1          ----------------------------------------------------------------------
1g8jA1          ----------------------------------------------------------------------
2c31A1          GAAYAQCDDEIRAL-VEETGIPFLPMGMAKGLLPDN--HPQSAAATRAF----ALAQCDVCVLIGARLNW
1q16A1          ----------------------------------------------------------------------
1oz4A1          ----------------------------------------------------------------------
1aa6A1          ----------------------------------------------------------------------
1ti2A1          ----------------------------------------------------------------------
1upaA1          -----------IPVITTYIAKGVLPVG---HELNYGAVTGYXDGILNFPALQTXFAPVDLVLTVGYDY--
1h0hA1          ----------------------------------------------------------------------
1dmrA1          ----------------------------------------------------------------------
1v37A           RFSLSAFQERVFRFLEGLKAPAVLFTHGGVVRA-------------------------------------
1cz4A1          ----------------------------------------------------------------------
2fug31          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AMGHIRRLTVAREKGXXXXXXDPRAPNLAYSSVEWIPINPGTDAAFVLSLIYVIISEGLYDAAFLKKYTN
1h0hA2          NHPISKWVMRAKDKGATLIHVDPRYTRTSTKCDLYAPLRSGSDIAFLNGMTKYILEKELYFKDYVVNYTN
1ogyA2          MLWSRLTDRRLSHEHVRVAVLSTFTHRSSDLSDTPIIFRPGTDRAILNYIAHHIISTGRVNRDFVDRHTN
1dmrA2          TSQIGPGLEALKAKGTKVIVIDPVRTKTVFFGAEHITPKPQTDVAIMLGMAHTLVAEDLYDKDFIANYTS
1aa6A2          SHPIVAHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRTE
1g8jA2          SQTNYLNHWLPNLQGATTSKKKERFPNENFPQARIIFVDPRETPSVAIARH------------VAGNDRV
1ti2A2          NSGIYIRRQWLKDLGVDFVFIDPHMNHTALVADKWFSPKIGTDHALSFAIAYTWLKEDSYDKEYVAANAH
1q16A2          TRTPDHFFTEVRYKGTKTVAVTPDYAEIAKLCDLWLAPKQGT------------------DAAM--ALAM
1a8eA           KHSTINLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVARSMGGKEDLIWELLNQEHFGKDKSK
1gqiA1          DHRMQSGRNLKYYQGVEQVRAMQR---------TWDQQEAYVDAARFAQVKALLQVQEREAVRWRNSCVL
1hq0A           ----------------------------------------------------------------------
2b20A1          ----------------------------------------------------------------------
1ozfA1          ----EYEPAMWNSGNATLVHIDVLPAYEERNYTPDVELV--GDIAGTLNKLAQNIDHRLVLSPQAAEILR
2fug32          VRDLKPPHRYNHRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLALLDKEGSEMVAKAKEAWEKAK
1ogyA1          ----------------------------------------------------------------------
1g8jA1          ----------------------------------------------------------------------
2c31A1          LM-QHGKGKTWGDELKKYVQIDIQANEMDSNQPIAAPV-VGDIKSAVSLLRKALKGAPKADAEWTGALKA
1q16A1          ----------------------------------------------------------------------
1oz4A1          ----------------------------------------------------------------------
1aa6A1          ----------------------------------------------------------------------
1ti2A1          ----------------------------------------------------------------------
1upaA1          AEDLRPSXW-QKGIEKKTVRISPTVNPIPRVYRPDVDV-VTDVLAFVEHFETATASFGAKQRHDIEPLRA
1h0hA1          ----------------------------------------------------------------------
1dmrA1          ----------------------------------------------------------------------
1v37A           ----------------------------------------------------------------------
1cz4A1          ----------------------------------------------------------------------
2fug31          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           APFLIKPDGQPLTQKDLGQEGTAYLVYDNAAKSLAPHDKAQDPALDYEGEVQTPAGVIKVKTAFRLLAER
1h0hA2          ASFIVG--------EGFAFEEGLFAGYNKETRKYDKSKWGF--ERDENGNPKRDETLKHPRCVFQIMKKH
1ogyA2          FALGATDIGYGL---------RPEHQLQLAAKGAA------------------DAGA-MTPTDFETFAAL
1dmrA2          ------------------------------------------------GFDKFLPYLDGETDSTPKTAEW
1aa6A2          GFEEYRKIVEGYTPES---------------------------------------------------VED
1g8jA2          LHLAIEP-------------GTDTALFNGLFTYVVEQGW------------IDKPFIEAHTKGFDDAVKT
1ti2A2          ----------------------------------GFEEWADYVLGKTDGTPKTCEWA-------------
1q16A2          GHVMLREFH-----------------LDNPSQYFTDYVRRYTDMPMLV---------------------M
1a8eA           EF--------------------------------------------------------------------
1gqiA1          ----------------------------------------------------------------------
1hq0A           ----------------------------------------------------------------------
2b20A1          ----------------------------------------------------------------------
1ozfA1          ----------------------------------------------------------------------
2fug32          NPVLI--LGAGVLQDTVAAERARLLA--ERAKVLAMTPAANARGLEAMGVLPGAKG--------------
1ogyA1          ----------------------------------------------------------------------
1g8jA1          ----------------------------------------------------------------------
2c31A1          ----------------------------------------------------------------------
1q16A1          ----------------------------------------------------------------------
1oz4A1          ----------------------------------------------------------------------
1aa6A1          ----------------------------------------------------------------------
1ti2A1          ----------------------------------------------------------------------
1upaA1          ----------------------------------------------------------------------
1h0hA1          ----------------------------------------------------------------------
1dmrA1          ----------------------------------------------------------------------
1v37A           ----------------------------------------------------------------------
1cz4A1          ----------------------------------------------------------------------
2fug31          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AAKYTPENAEKITGIPADTIRRIAREFATSRGVAEDGWYTAKNGNDFDAYRAILILNALVGNIDKRGGLC
1h0hA2          YERYDLDKISAICGTPKELILKVYDAYCATAGTIMYAMGWTQHTVGVQNIRAMSINNALRGEANVQGSTD
1ogyA2          VSEYTLEKAAEISGVEPALLEELAELYADPKWMSLWTMGFNQHVRGVWANHMVYNLHLLTGKISEPGNSP
1dmrA2          --------AEGISGVPAETIKELARLFESKRTMLAAGWSMQRMHHGEQAHWMLVTLASMLGQIGLPGGSY
1aa6A2          ITGVSASEIRQAARMYAQ----------AKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGV
1g8jA2          NR-LSLDECSNITGVPVDMLKRAAEWSYKPRTMHAYEKGIIWGNDNYVIQSALLDLVIATHNVGRRGTGC
1ti2A2          ---------EEESGVPACEIRALARQWAKKNTYGLGGWGGARASHGIEWARGMIALATMQGMGKPGSNMW
1q16A2          LEERDGYYAAGRMLRAADLVDALGQENNPEKTVAFNTNGEMVAPNGSIGFRWGEKGKWNLEQRDGKTGEE
1a8eA           ----------------------------------------------------------------------
1gqiA1          ----------------------------------------------------------------------
1hq0A           ----------------------------------------------------------------------
2b20A1          ----------------------------------------------------------------------
1ozfA1          ----------------------------------------------------------------------
2fug32          ----------------------------------------------------------------------
1ogyA1          ----------------------------------------------------------------------
1g8jA1          ----------------------------------------------------------------------
2c31A1          ----------------------------------------------------------------------
1q16A1          ----------------------------------------------------------------------
1oz4A1          ----------------------------------------------------------------------
1aa6A1          ----------------------------------------------------------------------
1ti2A1          ----------------------------------------------------------------------
1upaA1          ----------------------------------------------------------------------
1h0hA1          ----------------------------------------------------------------------
1dmrA1          ----------------------------------------------------------------------
1v37A           ----------------------------------------------------------------------
1cz4A1          ----------------------------------------------------------------------
2fug31          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           FQESSKFPSAVTVFQDRIETIIGHVLPPIKAQRLDRLKYPETPATFDALLDAIIEEKPYPVKALFIVATS
1h0hA2          HGLLMTYEEYTKKFTPVSKDPQSANWWSNFPKLNEAYGYLPKGEDGKDWLTLFDDMFQGKIKGFFAWGQN
1ogyA2          F--SLTGQPFACGTAREVGTFPADMVVTNPEHRAHAEEIWKLPAGLAHAVEQDRKLHDGEINFYWVQVNN
1dmrA2          HYSGGGTPSSGPALAGITDGGAATKGP--EWLAASGASVIPVARVVDMLEFNGTRSKFPDVKMAYWVGGN
1aa6A2          NPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAHTGYRISELPHRA---AHGEVRAAYIMGED
1g8jA2          VHQEGYTRPPYPGDKKIYI---DQELIKGKGRIMTWWGCNNFQTSNNAQALREAILQRSAIVKQAMQKAR
1ti2A2          SYAEGGISGDCENSAAGFKFAWRMFDGKTTFPSPSNLNTSAGQHIPRLHQYEYPAPGYSKIKMFWKYGGP
1q16A2          TELQLSLLGSQDEIAEVGFPYFGGDGTE----------HFNKVELENVLLHKLPVKRLQLADGSTALVTT
1a8eA           ----------------------------------------------------------------------
1gqiA1          ----------------------------------------------------------------------
1hq0A           ----------------------------------------------------------------------
2b20A1          ----------------------------------------------------------------------
1ozfA1          ----------------------------------------------------------------------
2fug32          ----------------------------------------------------------------------
1ogyA1          ----------------------------------------------------------------------
1g8jA1          ----------------------------------------------------------------------
2c31A1          ----------------------------------------------------------------------
1q16A1          ----------------------------------------------------------------------
1oz4A1          ----------------------------------------------------------------------
1aa6A1          ----------------------------------------------------------------------
1ti2A1          ----------------------------------------------------------------------
1upaA1          ----------------------------------------------------------------------
1h0hA1          ----------------------------------------------------------------------
1dmrA1          ----------------------------------------------------------------------
1v37A           ----------------------------------------------------------------------
1cz4A1          ----------------------------------------------------------------------
2fug31          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           PFHRDVNTXXXXXXXXXXXXIVAIDILPQDHIDWSDYVLPDLMFLEREEIGSIKWSLHAGIRYSHKVLDP
1h0hA2          PACSGANSNKTREALTKLDWMVNVNIFDNETGSFWRGPDMDPKKIKTEVFFLPCANSGRWMQWRYVGPEP
1ogyA2          NMQANIDQETYPGYRNPENFIVVSDAYPTVTGRAADLVLPAAMWVEKEGAYG---NAERRTHFWHQLVEA
1dmrA2          PFVHHQDRNRMVKAWEKLETFVVHDFQWTPTARHADIVLPATTSYERNDIETIGDYSNTGILAMKKIVEP
1aa6A2          PLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFT---AADRGFQRFFKAVEP
1g8jA2          GATTEEMVVIYEATQNGGLFVTSINLYPTKLAEAAHLMLPAAHPGEMN---LTSMNGERRIRLSEKFMDP
1ti2A2          HLGTATNRYAKMYTHDSLEFVVSQSIWFEGEVPFADIILPACTNFERWDIDNYQLCNHRVISLQAKCIEP
1q16A2          VYDLTLANYGLERGLNDVNCATSYDDVKAYTPAWAEQITGVSRSQIIRIAREFKTHGRSMIIVGAGLNHW
1a8eA           ----------------------------------------------------------------------
1gqiA1          ----------------------------------------------------------------------
1hq0A           ------------------------SIESTSKSNFQKLSRGNIDVLKGR--GSISSTRQRAIYPYFEAANA
2b20A1          ----------------------------------------------------------------------
1ozfA1          ----------------------------------------------------------------------
2fug32          ----------------------------------------------------------------------
1ogyA1          ----------------------------------------------------------------------
1g8jA1          ----------------------------------------------------------------------
2c31A1          ----------------------------------------------------------------------
1q16A1          ----------------------------------------------------------------------
1oz4A1          ----------------------------------------------------------------------
1aa6A1          ----------------------------------------------------------------------
1ti2A1          ----------------------------------------------------------------------
1upaA1          ----------------------------------------------------------------------
1h0hA1          ----------------------------------------------------------------------
1dmrA1          ----------------------------------------------------------------------
1v37A           ----------------------------------------------------------------------
1cz4A1          ----------------------------------------------------------------------
2fug31          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           PPGVDARSAFWALMEIIRRAFPEKAKIVEYDEKYADYNAFEHYEKKFFEAALRKLAETWKLDFEEIKEAL
1h0hA2          RK--NAIPDGDLIVELAKRAKTPGKLAAPVTKLKTDYWVNDHGHFDPHKIAKLINGFAL--------KDF
1ogyA2          PG--EARSDLWQLMEFSKRFTTDEVWPEEILSAAPAYRGKTLFEV------LFANGSVDRFPASDVNPDH
1dmrA2          LY--EARSDYDIFAAV--------AERLGKGAEFTEGKDEMGWIKSFYDDAAKQGKAAQMPAFDAFWAEP
1aa6A2          KW--DLKTDWQIISEIATR--------MGYPMHYNNT-------QEIWDELRHLCPDFYGATYEKMGELI
1g8jA2          PG--TAMADCLIAARIANAYQKDGKAEMAAQFEGFDWKTEEDAFNDGFRRAGQPGAPAILVTYDRLRKSG
1ti2A2          VG--ESMSDYEIYRLFAKKMFSEGKDELAWCEQY--FNATDMPKYMTWDEFFKKGYFVVPDNPNRKKTVA
1q16A2          YHLDMNYRGLINML--------------------------------------------------------
1a8eA           ----------------------------------------------------------------------
1gqiA1          ----------------------------------------------------------------------
1hq0A           DE--QQPLFFYIKKDRFDNHGYDQYFYDNTVGPNGIPTLNTYTGEIPSDSSSLGSTYWKKYNLTNETSII
2b20A1          ----------------------------------------------------------------------
1ozfA1          ----------------------------------------------------------------------
2fug32          ----------------------------------------------------------------------
1ogyA1          ----------------------------------------------------------------------
1g8jA1          ----------------------------------------------------------------------
2c31A1          ----------------------------------------------------------------------
1q16A1          ----------------------------------------------------------------------
1oz4A1          ----------------------------------------------------------------------
1aa6A1          ----------------------------------------------------------------------
1ti2A1          ----------------------------------------------------------------------
1upaA1          ----------------------------------------------------------------------
1h0hA1          ----------------------------------------------------------------------
1dmrA1          ----------------------------------------------------------------------
1v37A           ----------------------------------------------------------------------
1cz4A1          ----------------------------------------------------------------------
2fug31          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           ERDGFYILKKKTYETRPYKTPLGTPSGKVEIYTLRALKYGIDPLPDWIPPVYKIPQASDEFYLVNGKDNF
1h0hA2          KVGDVEYKAGQQIATFGHLQADGSTTSGCWIYTGSYTEKGNMAAR---------RDKTQTDMQAKIYPGW
1ogyA2          AN------------HEAALFGFYPQKGLFEEYAAFGRGHGHDLAPFDTYH----EVRGLHWPVVEGEETR
1dmrA2          VTDGADFVRYASFREDPLLNPLGTPTGLIEIYSKNIEKMGYDAHPTWMEPL-------------------
1aa6A2          QWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFDWVA----------------------------------
1g8jA2          NNGVQLPVVSWDESKGLVGTKFDTDDGKAHFKPWNG----------------------------------
1ti2A2          LRWKDTPDWGPRLNNQVCRKGLQTTTGKVEFIAQGYIDEHRPSMHTYVPAW-------------------
1q16A2          ----------------------------------------------------------------------
1a8eA           ----------------------------------------------------------------------
1gqiA1          ----------------------------------------------------------------------
1hq0A           RVSNSARGANGALEEVQEGKPVIITSGN---------------LSGCTTIVARKEGYIYKVH--TGTTKS
2b20A1          -----------------------LKVGSESWW----------------QSKHGPEWQRLNDFEVTFWWRD
1ozfA1          ----------------------------------------------------------------------
2fug32          ----------------------------------------------------------------------
1ogyA1          ------------------------------------------------------PDEEFGFWLVTGRVLE
1g8jA1          -------------------------------------------LPATVQQ----QKDKYRFWLNNGRNNE
2c31A1          ----------------------------------------------------------------------
1q16A1          ------------------------------------------------------SNGNQEKNFLTPHQKW
1oz4A1          ----------------------------------------------------------------------
1aa6A1          ------------------------------------------------------LTDEYPMVLSTVREVG
1ti2A1          ----------------------------------------------------------------------
1upaA1          ----------------------------------------------------------------------
1h0hA1          ----------------PMECPVIEHPFSKTLH---------NPTALHFATEEK-AVCDPRYICSTYRVTE
1dmrA1          ----------------------------------------------------------------------
1v37A           ----------------------------------------------------------------------
1cz4A1          ----------------------------------------------------------------------
2fug31          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           VSAHMVMVKNAKWIADRTVWMNPADAERLGIKDGDVVELEGLDNGFKAMAVVKVTNRVKPGVLFTYAFVG
1h0hA2          TWAWPVNRRIIYNRASVDLNGKPYAPEKAVVENAAEKKWVGDVPDGPWPPQADKEKGKRAFIMKPEGY--
1ogyA2          WRYREGFDPYVK-PGEGLRFYGKPDGRAVIL---------------------------------------
1dmrA2          ----------------------------------------------------------------------
1aa6A2          ----------------------------------------------------------------------
1g8jA2          ----------------------------------------------------------------------
1ti2A2          ----------------------------------------------------------------------
1q16A2          ----------------------------------------------------------------------
1a8eA           ----------------------------------------------------------------------
1gqiA1          ----------------------------------------------------------------------
1hq0A           LAGFTSTTGVKKAVEVLELLTKEPIPRVEGIMSNDFLVDYLSENFESEKKPDSQITIIRDNVSVFPYFLD
2b20A1          PQ-GSEEYSTIKRVWTGVTDHHQQPQSXQRIAGTDVWQWTTQLNANWRGSYCTERDDIFSAPSPDRLELR
1ozfA1          ----------------------------------------------------------------------
2fug32          ----------------------------------------------------------------------
1ogyA1          HWHSGSMTLRWPELYGAVCFMHPEDARSRGLNRGSEVRVISRRGEIRTRLETRGRNRMPRGVVFVPWFDA
1g8jA1          VWQTAYHDQYNSLMQERYIEMNPDDCKQLDVTGGDIVEVYN-DFG-STFAMVYPVAEIKRGQTFMLFGYV
2c31A1          ----------------------------------------------------------------------
1q16A1          GI-HSTYSDNLLMLTLGVVWLSEADAKDLGIADNDWIEVFN-SNG-ALTARAVVSQRVPAGMTMMYHAQE
1oz4A1          ------IVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKG-KKRREAVCIVLSDDTCSDEKIR------
1aa6A1          HYSCRSMTGNCAALAALAAQINTEDAKRLGIEDEALVWVHS-RKG-KIITRAQVSDRPNKGAIYMT----
1ti2A1          ------------------MRVNSIDAEARGIKNGDLIRAYN-DRG-SVILAAQVTECLQPGTVHSY-ESC
1upaA1          ----------------------------------------------------------------------
1h0hA1          HWQTGLMTRNTPWLLEAECEMSEELATLRGIKNGDKVILES-VRG-KLWAKAIITKRIKPFA--------
1dmrA1          ------------------CLMHPDDAAARGIADGDVVRVHN-DRG-QILTGVKVTDAVMKGVIQIY----
1v37A           ----------------------------------------------------------------------
1cz4A1          --------------------LDESSRRLLDAEIGDVVEIEK-VRKTVGRVYRARPEDENKGI--------
2fug31          -------------------WAHPETARAEALPEGAQVAVET-PFG-RVEARVVHREDVPKGHLYLSA---


                         .         .         *         .         .         .         .:840
query           GRTSKLISGEYQFLKEGINPQWFTTGKVEPVVGSAPTNSSVRVRRx
1h0hA2          ----------------------------------------------
1ogyA2          ----------------------------------------------
1dmrA2          ----------------------------------------------
1aa6A2          ----------------------------------------------
1g8jA2          ----------------------------------------------
1ti2A2          ----------------------------------------------
1q16A2          ----------------------------------------------
1a8eA           ----------------------------------------------
1gqiA1          ----------------------------------------------
1hq0A           NI--------------------------------------------
2b20A1          EGWRKLLPQAIADPLNPQSWKGGLGHAVSALXPQAP----------
1ozfA1          ----------------------------------------------
2fug32          ----------------------------------------------
1ogyA1          SQ--------------------------------------------
1g8jA1          NGIQGDVTTDW--TDRDIIPYYKGTWDIRKVGSMSEFKRTVSFKS-
2c31A1          ----------------------------------------------
1q16A1          RI--VNLPGSEITQQRGGIHNSVTRITPKPTHMIGGYAHLAYGFN-
1oz4A1          ----------------------------------------------
1aa6A1          ----------------------------------------------
1ti2A1          AVYDPLGTAGKSADRGGCINILTPDRYISKYACGMANNTAVEIEK-
1upaA1          ----------------------------------------------
1h0hA1          ----------------------------------------------
1dmrA1          ----------------------------------------------
1v37A           ----------------------------------------------
1cz4A1          ----------------------------------------------
2fug31          ----------------------------------------------