[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL64528.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1fjgJ.bssp"

## Summary of PDB Search
:106
    1e-21  40%  1fjgJ  [d.58.15.1] 30S RIBOSOMAL PROTEIN S10
:106

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxKVRIRLYGTNPADVEQVAREIVDLAKKMGVQVRGPIPLPTRRLIVTVRRAPSGQGYHTFDHWE
1fjgJ           -------KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGP-FKHKDSREHFE


                         .         .         *         .         .         .         .:140
query           MRISKRLIDIEASERVLRRLMTIRVPDTVKIELQxx
1fjgJ           LRTHNRLVDIINNRKTIEQLMTLDLPTGVEIEIK--