[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL64645.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1lnqA4.bssp"
#ERROR : Can't open dsspfile "1vctA2.bssp"

## Summary of PDB Search
:546
    4e-08  33%  1lnqA4 [d.286.1.1] POTASSIUM CHANNEL RELATED PROTEIN A:245 -- 336
    2e-07  24%  1vctA2 [d.286.1.1] HYPOTHETICAL PROTEIN PH0236 A:108 -- 201
:546

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lnqA4          ----------------------------------------------------------------------
1vctA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lnqA4          ----------------------------------------------------------------------
1vctA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lnqA4          ----------------------------------------------------------------------
1vctA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDIPSFMTSKDLILRPLGNNKGEH
1lnqA4          -----------------------------------------------DGYEAMFVQDVLAE----ESTRR
1vctA2          -----------------------------------------------------------------EGEEI


                         .         *         .         .         .         .         +:350
query           MEFLIVTQRSRLVGKTLALEPIHNVFPVSIIGIVPSGPVESLESYVFRPGDEILVLGDEKVIERIAAYYR
1lnqA4          MVEVPIPEGSKLEGVSVLDADIHDVTGVIIIGVDPPR------DYSFRAGDIILGIGKPEEIERLKNYIS
1vctA2          IGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIAR


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lnqA4          ----------------------------------------------------------------------
1vctA2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lnqA4          ----------------------------------------------------------------------
1vctA2          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1lnqA4          --------------------------------------------------------
1vctA2          --------------------------------------------------------