[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL64884.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1cp2A.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "1f48A1.bssp"
#ERROR : Can't open dsspfile "1f48A2.bssp"
#ERROR : Can't open dsspfile "1g3qA.bssp"

## Summary of PDB Search
:222
    1e-09  16%  1cp2A  [c.37.1.10] NITROGENASE IRON PROTEIN
    2e-06  18%  1eg7A  [c.37.1.10] FORMYLTETRAHYDROFOLATE SYNTHETASE
    6e-06  23%  1f48A1 [c.37.1.10] ARSENITE-TRANSLOCATING ATPASE A:1 -- 296
    7e-05  21%  1f48A2 [c.37.1.10] ARSENITE-TRANSLOCATING ATPASE A:309 -- 586
    3e-04  47%  1g3qA  [c.37.1.10] CELL DIVISION INHIBITOR
:222

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxTVAFTSCKGGAGKTTLAVNVSAALPLNVLLIDLGGGASRFFPAPLINIENITPTIEAYRDARVKN
1cp2A           ------QVAIYGKGGIGKSTTTQNLTSGLGKTIMVVGLLGGLAQKSVLDTLREEGEDVELDSILKEGYGG
1eg7A           ------TAITPTPAGEGKTTTSVGLTDALGKRVMVCLIKGGAAG--GGYAQVVPMEDINLHFTGDIHAVT
1f48A1          --------FFTGKGGVGKTSISCATAIRLAERVLLVSTDPASN----VGQVFSQTIGNTIQAIAS--VPG
1f48A2          -----GLIMLMGKGGVGKTTMAAAIAADMGFDVHLTT--SDPAAHLNNLQVSRIDPHEETERYRQHVLET
1g3qA           ------ISIVSGKGGTGKTTVTANLSVALGRKVLAVDG--------------------------------


                         .         .         *         .         .         .         .:140
query           LFVIPIAIDPASVWRIENWEEIFQNLTDAVRKNIVKNSIDVVVLDMYQLSRITPIETFGLDKADLIVLVV
1cp2A           IRCVESGGPEPGVGCA--GRGIITSINMLEQLGAYTDDLDYVFYDVLDVVCGGFAMPIREGKAQEIYIVA
1eg7A           YAHNLLAAMVDNHLQQGNV------LNIDPRTITWRRVIDLNERALRNIVIGLGGKANGVPRET------
1f48A1          LSALEIDPQAAAQ---QYRARIVDPIKGVLPDDVVSS---------------------------------
1f48A2          KGKELDEAGKRLLERSPCTEEIA--VFQAFSRVIREAGKRFVVMDT------------------------
1g3qA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EGCEDCTKPITIIKKFFDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1cp2A           SGEMMALYAANNISKGIQ----------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1f48A1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1g3qA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxx
1cp2A           ------------
1eg7A           ------------
1f48A1          ------------
1f48A2          ------------
1g3qA           ------------