[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL64909.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1k3rA2.bssp"
#ERROR : Can't open dsspfile "1k3rA1.bssp"
#ERROR : Can't open dsspfile "1vhkA2.bssp"
#ERROR : Can't open dsspfile "1k3rA2.bssp"

## Summary of PDB Search
:270
    6e-11  33%  1k3rA2 [c.116.1.2] CONSERVED PROTEIN MT0001 A:1 -- 92 A:164 -- 262
    1e-06  25%  1k3rA1 [b.40.4.10] CONSERVED PROTEIN MT0001 A:93 -- 163
    8e-04  24%  1vhkA2 [c.116.1.5] HYPOTHETICAL PROTEIN YQEU A:74 -- 253
    1e-06  30%  1k3rA2 [c.116.1.2] CONSERVED PROTEIN MT0001 A:1 -- 92 A:164 -- 262(query 175->260)
:270

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxSIAIPHDFLSEIPDEAGKVRKLGYLARAAAIFKAEYIIIYHYGTPRREDIDFAKTVLEYLVTPPYLRK
1k3rA2          --SLFIPDSLTAETGDLKIKTYKVVLIARAASIFGVKRIVIYH--DDADGEARFIRDILTYMDTPQYLRR
1k3rA1          ----------------------------------------------------------------------
1vhkA2          ----------------------------------------------------------------------
1k3rA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KVYKIDNRLKLAGLLPPLKIPSHTVPVEPRIGEIREGIVERWDGYYSLIYIGGGKYAKVPKPYPIGTRLL
1k3rA2          KVFPIMRELKHVGILPPLRTGYEVLDTRRNLAESLKTVGADV----------------------------
1k3rA1          --------------------PHHPTG-KPVTGEYRQGLTVKRVKKGTLVDIGADKLALCREKLTVNRIMS
1vhkA2          ----------------------------------------------------------------------
1k3rA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VRIxxxxxxxxxxxxxxxxxxxxxxxxxxIDVRPLQNLSEGFDTVILTGKEGKSICEAKPKIGKKTLVVF
1k3rA2          ----------------------------------------------------------------------
1k3rA1          FRV-------------------------------------------------------------------
1vhkA2          -----------------------------HSFQQLLQRXQDFDKCVVAYESAFSAIVSSLPKGSSLLIVF
1k3rA2          ----------------------------------LAESLKTVGADVVVATSRNASPITSIRGAREAAILF


                         .         .         .         +         .         .         .:280
query           GGPRKGVDEIFREAGLEPPGELINFAPGQGVETIRTEEAVFIVLSILNYIxxxxxxxxxx
1k3rA2          ------------------------------------------------------------
1k3rA1          ------------------------------------------------------------
1vhkA2          GGLTEAEVERLTEQDGVT----CGL----GPRILRTETAPLYALSAISY-----------
1k3rA2          GGPYKGLPEIDADI-------WVNTLPGQCTETVRTEEAVLATLSVFNML----------