[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL64927.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ug9A3.bssp"
#ERROR : Can't open dsspfile "1ufaA2.bssp"
#ERROR : Can't open dsspfile "1k1wA3.bssp"
#ERROR : Can't open dsspfile "1htyA3.bssp"
#ERROR : Can't open dsspfile "2b5dX2.bssp"
#ERROR : Can't open dsspfile "2c1gA1.bssp"
#ERROR : Can't open dsspfile "2ba0D2.bssp"
#ERROR : Can't open dsspfile "1ny1A.bssp"

## Summary of PDB Search
:999
    2e-59  30%  1ug9A3 [b.1.9.3] GLUCODEXTRANASE A:776 -- 1020
    1e-21  23%  1ufaA2 [c.6.2.4] TT1467 PROTEIN A:1 -- 412
    3e-18  19%  1k1wA3 [c.6.2.2] 4-ALPHA-GLUCANOTRANSFERASE A:4 -- 310
    6e-14  14%  1htyA3 [c.6.2.1] ALPHA-MANNOSIDASE II A:31 -- 411
    7e-14  13%  2b5dX2 [c.6.2.4] ALPHA-AMYLASE X:1 -- 404
    8e-09  20%  2c1gA1 [c.6.2.3] PEPTIDOGLYCAN GLCNAC DEACETYLASE A:268 -- 463
    6e-04  17%  2ba0D2 [d.101.1.1] ARCHEAL EXOSOME RNA BINDING PROTEIN RRP41 D:154
    7e-04  21%  1ny1A  [c.6.2.3] PROBABLE POLYSACCHARIDE DEACETYLASE PDAA
:999

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ug9A3          ----------------------------------------------------------------------
1ufaA2          ----------------------------------------------------------------------
1k1wA3          ----------------------------------------------------------------------
1htyA3          ----------------------------------------------------------------------
2b5dX2          ----------------------------------------------------------------------
2c1gA1          ----------------------------------------------------------------------
2ba0D2          ----------------------------------------------------------------------
1ny1A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ug9A3          ----------------------------------------------------------------------
1ufaA2          ----------------------------------------------------------------------
1k1wA3          ----------------------------------------------------------------------
1htyA3          ----------------------------------------------------------------------
2b5dX2          ----------------------------------------------------------------------
2c1gA1          ----------------------------------------------------------------------
2ba0D2          ----------------------------------------------------------------------
1ny1A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWIDPYIARQNPEIWALRNKTNYTREDLKKVLQIHL
1ug9A3          ----------------------------------------------------------------------
1ufaA2          -----------------------------------YAKDRLERAQGDYQALEASARHQVAFWELTLDHFQ
1k1wA3          -----------------------------------------------------------------LEWIE
1htyA3          ----------------------------------------------------------------FARFYH
2b5dX2          --------------------------------------------------------FYREHFEKILNVFR
2c1gA1          ----------------------------------------------------------------------
2ba0D2          ----------------------------------------------SIALLQMDGRMTRDEVKQAIELAK
1ny1A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ELIKQVLPVYKKLAEQGRIELVPVPYSHPLMPLLADMGAIYDLKLHVNLSNSLFKRYLGVTPTGVWPPEQ
1ug9A3          ----------------------------------------------------------------------
1ufaA2          RLSGDLVAAFRKAEEGGQVELITSNATHGYSPLLG-----YDEALWAQIKTGVYRRHFAKDPTGFWLPEX
1k1wA3          ENKPDYLDLLRSLIKRGQLEIVVAGFYEPVLAAIPK----EDRLVQIEXLKDYARK-LGYDAKGVWLTER
1htyA3          DLGENKKLQXKSIVKNGQLEFVTGGWVXPDEANSHW----RNVLLQLTEGQTWLKQFXNVTPTASWIDPF
2b5dX2          SYDGNILEGFKKYQETGKLEIVTCNATHAFLPLYQMYPE--VVNAQITVGVKNYEKHMKKHPRGIWLAEC
2c1gA1          -----------------------------------------EAKKQITDTEDVLTKVLGSSSKLMRPPYG
2ba0D2          KGALQIYEMQREAILRRYIEVGE-----------------------------------------------
1ny1A           -------------------------FHHPDLTTKTADQIQDEL----DSVNEEVYKITGKQDNLYLPPRG


                         .         *         .         .         .         .         +:350
query           AVNDEVLRLFANAGYIWTVTDEDVLKATAPGASHFKLYFVQYGDRKLYVFFRDKTLSDNIGFRYSSLSPE
1ug9A3          ----------------------------------------------------------------------
1ufaA2          AVRPGVDELLXRAGIRYTFVDAHLVEPLSPVESQEATYHVHELESGLRVLARNPETTLQVWSADYGYPGE
1k1wA3          VWQPELVKSLREAGIEYVVVDDYHFXSAGLSKEEFWPYYTEDGGEVITVFPIDEKLRYLIPFR-------
1htyA3          GHSPTXPYILQKSGFKNMLIQRTHY--------SVKKELAQQRQLEFLWRQIWDNKGDTALFTHXXPFYS
2b5dX2          GYYQGLDLYLAQNNVEYFFVDSHAFWFADEQPRYGVYRPIMTP-SGVFAFARDPESSEQVWSAAVGYPGD
2c1gA1          AITDDIRNSLDLSFIMWDVDSLDWKSKNEASILTEIQHQVANGSIVLMHDIHSPTV--------------
2ba0D2          ----------------------------------------------------------------------
1ny1A           VFSEYVLKETKRLGYFWSVAFVDWKINNQKGK--------------------------------------


                         .         .         .         .         *         .         .:420
query           AALADFVNYLKRVPREKCSVVVIALDGENPWENYPNFGDDFLRVFFQGLAQLEKNGTVKIWKPSDFIKAC
1ug9A3          ----------------------------------------------------------------------
1ufaA2          GLYREF----------------------------------------------------------------
1k1wA3          -PVKKTIEYLESLSKV-------AVFHDDGEKFGVWPGTYWLREFFDAITEK-----INLXTYSEYL---
1htyA3          YDIPHTCGPDPKVCCQFDFKRXGSFGLSCPWKVPPRTISDRSDLLVQWKKKAELYRTNVLLIPDDFRFKQ
2b5dX2          PRYREFYRDIGFDREMEYIKDYIDPSGVRINTGIKYHRITSKSLDASQKEYYDIDLAMEAVEE-------
2c1gA1          NALPRVIEYLKN----------------------------------------------------------
2ba0D2          ----------------------------------------------------------------------
1ny1A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GNEAAELPQREFKYFDLHLDLSFYKSIRDLPTRLVNGRIAEGSWSGGGSLAVWIGDPDENVWWMWLKKAR
1ug9A3          ----------------------------------------------------------------------
1ufaA2          ----------------------------------------------------------------------
1k1wA3          ----SKFTPRGLVY------------------------LPIASY---FEXSEWSLPAKQAKLFVEFVEQL
1htyA3          NTEWRVNYERLFEHINSQAHFNQFGTLQEYFDAV---HQAERAG--QAEFPTLSGD--------------
2b5dX2          --HARDFLHKKESQARRLMDIMGV---EPVIVAPFDAELFGHWWFEG---------------VFFLKRFF
2c1gA1          ----------------------------------------------------------------------
2ba0D2          ----------------------------------------------------------------------
1ny1A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           EEVGVNRTWDVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ug9A3          ----------------------------------------------------------------------
1ufaA2          ----------------------------------------------------------------------
1k1wA3          KEEGKFEKY-------------------------------------------------------------
1htyA3          ----------------------------------------------------------------------
2b5dX2          ELVNESKDLKL-----------------------------------------------------------
2c1gA1          ----------------------------------------------------------------------
2ba0D2          ----------------------------------------------------------------------
1ny1A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ug9A3          ----------------------------------------------------------------------
1ufaA2          ----------------------------------------------------------------------
1k1wA3          ----------------------------------------------------------------------
1htyA3          ----------------------------------------------------------------------
2b5dX2          ----------------------------------------------------------------------
2c1gA1          ----------------------------------------------------------------------
2ba0D2          ----------------------------------------------------------------------
1ny1A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxADPVGDD
1ug9A3          ---------------------------------------------------------------SDPAGDD
1ufaA2          ----------------------------------------------------------------------
1k1wA3          ----------------------------------------------------------------------
1htyA3          ----------------------------------------------------------------------
2b5dX2          ----------------------------------------------------------------------
2c1gA1          ----------------------------------------------------------------------
2ba0D2          ----------------------------------------------------------------------
1ny1A           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           FGPGRYQYPKNPVFKPGVFDLTEFSLYDVGDKLRFVFKVRELGDNPWGGPAGFSLQFFHVYINRGSGSRN
1ug9A3          NGPGTYRYPTNSAYVPGAFDLTGVDVYDAGDDYAFVATIAGEVTNPWGGQ-AISHQRVNIYLGKGEGGAT
1ufaA2          ----------------------------------------------------------------------
1k1wA3          ----------------------------------------------------------------------
1htyA3          ----------------------------------------------------------------------
2b5dX2          ----------------------------------------------------------------------
2c1gA1          ----------------------------------------------------------------------
2ba0D2          ----------------------------------------------------------------------
1ny1A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           DTLGLRVALCRDAAWDVALLIGPGWSGGNRIVYSDNTYVDDAMSIKVAPNNTVVADVPKRYIGEFNSSWK
1ug9A3          PGLGTNINL--EHAWDSVIVT-DGRFDGAGVYAPDGTRTSAVSLLAVPEARQIVTRVPKAALGPATARMS
1ufaA2          ----------------------------------------------------------------------
1k1wA3          ----------------------------------------------------------------------
1htyA3          ----------------------------------------------------------------------
2b5dX2          ----------------------------------------------------------------------
2c1gA1          ----------------------------------------------------------------------
2ba0D2          ----------------------------------------------------------------------
1ny1A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           ITVFLTSWDGYGPDNIRNFGVVSDEWTAGGADPVAVLANVAPRVFDLLAETAEQQIKALTSYQVTRLPNG
1ug9A3          VAMFGNAESGEGIGNVRPVYDWIKEWRFGGGAPSRDTDTDDPNALDVLVGEGQTQAAVLDWRAGSPV--V
1ufaA2          ----------------------------------------------------------------------
1k1wA3          ----------------------------------------------------------------------
1htyA3          ----------------------------------------------------------------------
2b5dX2          ----------------------------------------------------------------------
2c1gA1          ----------------------------------------------------------------------
2ba0D2          ----------------------------------------------------------------------
1ny1A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           TYLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ug9A3          VPM-------------------------------------------------------------------
1ufaA2          ----------------------------------------------------------------------
1k1wA3          ----------------------------------------------------------------------
1htyA3          ----------------------------------------------------------------------
2b5dX2          ----------------------------------------------------------------------
2c1gA1          ----------------------------------------------------------------------
2ba0D2          ----------------------------------------------------------------------
1ny1A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxx
1ug9A3          -------------------
1ufaA2          -------------------
1k1wA3          -------------------
1htyA3          -------------------
2b5dX2          -------------------
2c1gA1          -------------------
2ba0D2          -------------------
1ny1A           -------------------