[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL64945.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b0pA4.bssp"

## Summary of PDB Search
:181
    4e-04  16%  1b0pA4 [c.64.1.1] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
:181

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxAALAEGYDVRIAEVHGMSQRGGSVEVHVRYGKDIYAPIVEEGGADY
1b0pA4          ------------------------IGDNTDLFAQGYFSYDSKKSGGITISHLRFGEKPIQSTYLVNRADY


                         .         .         *         .         .         .         .:140
query           VIALEALEALRAYKYLKRGGELIVNRRVIQPPGNWLEEEEVFKAILTSGLKSYIVPCFDIAIELGSPLYE
1b0pA4          VACHNPAYVGILEGIKDGGTFVLNSPWSSLEDMDKHLPSGIKRTIANKKLKFYNIDAVKIATDVGLGGRI


                         +         .         .         .         .         *         .:210
query           NAVMLGFFSQLAGLPMPPSLDERNREAFRRxxxxxxxxxxx
1b0pA4          NMIMQTAFFKLAGVLPFEKAVDLLKKSIHK-----------