[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL64946.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ni4A.bssp"
#ERROR : Can't open dsspfile "1durA.bssp"
#ERROR : Can't open dsspfile "1b0pA2.bssp"
#ERROR : Can't open dsspfile "1hfeL2.bssp"
#ERROR : Can't open dsspfile "1zpdA3.bssp"
#ERROR : Can't open dsspfile "1kf6B1.bssp"
#ERROR : Can't open dsspfile "1powA3.bssp"
#ERROR : Can't open dsspfile "2gmhA3.bssp"
#ERROR : Can't open dsspfile "1jb0C.bssp"
#ERROR : Can't open dsspfile "1upaA3.bssp"
#ERROR : Can't open dsspfile "1jnrB.bssp"
#ERROR : Can't open dsspfile "1kqfB1.bssp"
#ERROR : Can't open dsspfile "1iqzA.bssp"
#ERROR : Can't open dsspfile "2fug91.bssp"
#ERROR : Can't open dsspfile "2v4jA1.bssp"
#ERROR : Can't open dsspfile "1dtwA.bssp"
#ERROR : Can't open dsspfile "1bluA.bssp"
#ERROR : Can't open dsspfile "1um9A.bssp"
#ERROR : Can't open dsspfile "1ozfA3.bssp"
#ERROR : Can't open dsspfile "2v4jB1.bssp"
#ERROR : Can't open dsspfile "1a6lA.bssp"
#ERROR : Can't open dsspfile "1gt8A1.bssp"
#ERROR : Can't open dsspfile "1h98A.bssp"
#ERROR : Can't open dsspfile "1nekB1.bssp"
#ERROR : Can't open dsspfile "1ovmA3.bssp"
#ERROR : Can't open dsspfile "1c4aA3.bssp"
#ERROR : Can't open dsspfile "1xerA.bssp"
#ERROR : Can't open dsspfile "1gt8A5.bssp"
#ERROR : Can't open dsspfile "1l8aA1.bssp"
#ERROR : Can't open dsspfile "1bfdA3.bssp"
#ERROR : Can't open dsspfile "1ti2B2.bssp"
#ERROR : Can't open dsspfile "1b0pA5.bssp"
#ERROR : Can't open dsspfile "2c31A3.bssp"
#ERROR : Can't open dsspfile "2c31A2.bssp"
#ERROR : Can't open dsspfile "2fug34.bssp"
#ERROR : Can't open dsspfile "2akjA3.bssp"
#ERROR : Can't open dsspfile "1jscA2.bssp"
#ERROR : Can't open dsspfile "1fxdA.bssp"
#ERROR : Can't open dsspfile "1upaA2.bssp"
#ERROR : Can't open dsspfile "1bfdA2.bssp"
#ERROR : Can't open dsspfile "1powA2.bssp"
#ERROR : Can't open dsspfile "1c7sA2.bssp"
#ERROR : Can't open dsspfile "1ozfA2.bssp"
#ERROR : Can't open dsspfile "1dtwB2.bssp"

## Summary of PDB Search
:390
    9e-12  22%  1ni4A  [c.36.1.11] PYRUVATE DEHYDROGENASE E1 COMPONENT: ALPHA
    1e-11  35%  1durA  [d.58.1.1] 2[4FE-4S] FERREDOXIN
    2e-11  16%  1b0pA2 [c.36.1.12] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
    5e-11  26%  1hfeL2 [d.58.1.5] PROTEIN (FE-ONLY HYDROGENASE (E.C.1.18.99.1) L:2
    5e-11  15%  1zpdA3 [c.36.1.9] PYRUVATE DECARBOXYLASE A:363 -- 566
    9e-11  12%  1kf6B1 [a.1.2.1] FUMARATE REDUCTASE IRON-SULFUR PROTEIN B:106 --
    1e-10  17%  1powA3 [c.36.1.9] PYRUVATE OXIDASE A:366 -- 593
    2e-10  12%  2gmhA3 [d.58.1.6] ELECTRON TRANSFER FLAVOPROTEIN-UBIQUINONE A:483
    2e-10  22%  1jb0C  [d.58.1.2] PHOTOSYSTEM I IRON-SULFUR CENTER
    2e-10  19%  1upaA3 [c.36.1.9] CARBOXYETHYLARGININE SYNTHASE A:375 -- 572
    3e-10  24%  1jnrB  [d.58.1.5] ADENYLYLSULFATE REDUCTASE
    3e-10  22%  1kqfB1 [d.58.1.5] FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, IRON-
    3e-10  24%  1iqzA  [d.58.1.4] FERREDOXIN
    3e-10  24%  2fug91 [d.58.1.5] NADH-QUINONE OXIDOREDUCTASE CHAIN 9 9:26 -- 179
    3e-10  16%  2v4jA1 [d.58.1.5] SULFITE REDUCTASE, DISSIMILATORY-TYPE SUBUNIT
    4e-10  13%  1dtwA  [c.36.1.11] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE
    4e-10  26%  1bluA  [d.58.1.1] FERREDOXIN
    5e-10  23%  1um9A  [c.36.1.11] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT
    7e-10  17%  1ozfA3 [c.36.1.9] ACETOLACTATE SYNTHASE, CATABOLIC A:367 -- 554
    2e-09  14%  2v4jB1 [d.58.1.5] SULFITE REDUCTASE, DISSIMILATORY-TYPE SUBUNIT
    3e-09  21%  1a6lA  [d.58.1.2] FERREDOXIN
    3e-09  13%  1gt8A1 [a.1.2.2] DIHYDROPYRIMIDINE DEHYDROGENASE A:2 -- 183
    7e-09  24%  1h98A  [d.58.1.2] FERREDOXIN
    9e-09  10%  1nekB1 [a.1.2.1] SUCCINATE DEHYDROGENASE IRON-SULFUR PROTEIN B:107
    2e-08  14%  1ovmA3 [c.36.1.9] INDOLE-3-PYRUVATE DECARBOXYLASE A:356 -- 551
    2e-08  26%  1c4aA3 [d.58.1.5] PROTEIN (FE-ONLY HYDROGENASE) A:127 -- 209
    2e-08  28%  1xerA  [d.58.1.3] FERREDOXIN
    4e-08  24%  1gt8A5 [d.58.1.5] DIHYDROPYRIMIDINE DEHYDROGENASE A:845 -- 1020
    4e-08  17%  1l8aA1 [c.36.1.10] PYRUVATE DEHYDROGENASE E1 COMPONENT A:56 -- 470
    5e-08  14%  1bfdA3 [c.36.1.9] BENZOYLFORMATE DECARBOXYLASE A:342 -- 524
    2e-07  26%  1ti2B2 [d.58.1.5] PYROGALLOL HYDROXYTRANSFERASE SMALL SUBUNIT B:1
    2e-07  14%  1b0pA5 [d.58.1.5] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
    3e-07  25%  2c31A3 [c.36.1.9] OXALYL-COA DECARBOXYLASE A:370 -- 552
    2e-06  15%  2c31A2 [c.36.1.5] OXALYL-COA DECARBOXYLASE A:7 -- 194
    2e-06  17%  2fug34 [d.58.1.5] NADH-QUINONE OXIDOREDUCTASE CHAIN 3 3:96 -- 246
    3e-06  11%  2akjA3 [d.134.1.1] FERREDOXIN--NITRITE REDUCTASE, CHLOROPLAST A:431
    4e-06  20%  1jscA2 [c.36.1.5] ACETOHYDROXY-ACID SYNTHASE A:83 -- 270
    7e-06  20%  1fxdA  [d.58.1.4] FERREDOXIN II
    1e-05   7%  1upaA2 [c.36.1.5] CARBOXYETHYLARGININE SYNTHASE A:12 -- 197
    1e-05  14%  1bfdA2 [c.36.1.5] BENZOYLFORMATE DECARBOXYLASE A:2 -- 181
    4e-05  18%  1powA2 [c.36.1.5] PYRUVATE OXIDASE A:9 -- 182
    8e-05   5%  1c7sA2 [b.2.2.3] BETA-N-ACETYLHEXOSAMINIDASE A:28 -- 200
    2e-04  13%  1ozfA2 [c.36.1.5] ACETOLACTATE SYNTHASE, CATABOLIC A:7 -- 187
    4e-04  18%  1dtwB2 [c.48.1.2] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE
:390

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxDVVIVTSGVAYNYVKEAVRRLNIRATVVKLGISVPVPPKVREIARxxxx
1ni4A           ----------------------------------------------------------------------
1durA           ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------------------------
1hfeL2          ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1kf6B1          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
2gmhA3          ----------------------------------------------------------------------
1jb0C           ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
1jnrB           ----------------------------------------------------------------------
1kqfB1          ----------------------------------------------------------------------
1iqzA           ----------------------------------------------------------------------
2fug91          ----------------------------------------------------------------------
2v4jA1          ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
1bluA           ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
1ozfA3          ----------------------------------------------------------------------
2v4jB1          ----------------------------------------------------------------------
1a6lA           ----------------------------------------------------------------------
1gt8A1          ----------------------------------------------------------------------
1h98A           ----------------------------------------------------------------------
1nekB1          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
1c4aA3          ----------------------------------------------------------------------
1xerA           ----------------------------------------------------------------------
1gt8A5          ----------------------------------------------------------------------
1l8aA1          ----------------------------------------------------------------------
1bfdA3          ----------------------------------------------------------------------
1ti2B2          ----------------------------------------------------------------------
1b0pA5          ----------------------------------------------------------------------
2c31A3          ----------------------------------------------------------------------
2c31A2          ----------------------------------------------------------------------
2fug34          ----------------------------------------------------------------------
2akjA3          ----------------------------------------------------------------------
1jscA2          ----------------------------------------------------------------------
1fxdA           ----------------------------------------------------------------------
1upaA2          ----------------------------------------------------------------------
1bfdA2          ----------------------------------------------------------------------
1powA2          ----------------------------------------------------------------------
1c7sA2          ----------------------------------------------------------------------
1ozfA2          ----------------------------------------------------------------------
1dtwB2          ---------------------DVTLVAWGTQVHVIREVASMAGVSCEVIDLRTIIPWDVDICKSVI----


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ni4A           ----------------------------------------------------------------------
1durA           ----------------------------------------------------------------------
1b0pA2          ----------------------------------------------------------------------
1hfeL2          ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1kf6B1          ----------------------------------------------------------------------
1powA3          ----------------------------------------------------------------------
2gmhA3          ----------------------------------------------------------------------
1jb0C           ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
1jnrB           ----------------------------------------------------------------------
1kqfB1          ----------------------------------------------------------------------
1iqzA           ----------------------------------------------------------------------
2fug91          ----------------------------------------------------------------------
2v4jA1          ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
1bluA           ----------------------------------------------------------------------
1um9A           ----------------------------------------------------------------------
1ozfA3          ----------------------------------------------------------------------
2v4jB1          ----------------------------------------------------------------------
1a6lA           ----------------------------------------------------------------------
1gt8A1          ----------------------------------------------------------------------
1h98A           ----------------------------------------------------------------------
1nekB1          ----------------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------------
1c4aA3          ----------------------------------------------------------------------
1xerA           ----------------------------------------------------------------------
1gt8A5          ----------------------------------------------------------------------
1l8aA1          ----------------------------------------------------------------------
1bfdA3          ----------------------------------------------------------------------
1ti2B2          ----------------------------------------------------------------------
1b0pA5          ----------------------------------------------------------------------
2c31A3          ----------------------------------------------------------------------
2c31A2          ----------------------------------------------------------------------
2fug34          ----------------------------------------------------------------------
2akjA3          ----------------------------------------------------------------------
1jscA2          ----------------------------------------------------------------------
1fxdA           ----------------------------------------------------------------------
1upaA2          ----------------------------------------------------------------------
1bfdA2          ----------------------------------------------------------------------
1powA2          ----------------------------------------------------------------------
1c7sA2          ----------------------------------------------------------------------
1ozfA2          ----------------------------------------------------------------------
1dtwB2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxHMATFYILRLATAGLNPVWSGDIGCYSLGINTGQQDLITHMGSSVGLGAGIALATGQFVVATVG
1ni4A           ---------------------------------------------IVGAQVPLGAGIALAKDEVCLTLYG
1durA           ----------------------------------------------------------------------
1b0pA2          --------------------------------------------GQKDGLLGQIAAMSDLYKKSVWIFGG
1hfeL2          ----------------------------------------------------------------------
1zpdA3          ---------------EALLTPNTTVIAETGDSWFNAQREYEMQWGHIGWSVPAAFGYAVGAPERNILMVG
1kf6B1          ----------------------------------------------------------------------
1powA3          ---------------NKIAEPDAIYSIDVGDINLNANRITSNLFATMGVGIPGAIAAKLNYERQVFNLAG
2gmhA3          ----------------------------------------------------------------------
1jb0C           ----------------------------------------------------------------------
1upaA3          ---------------------EGTIVSDIGFFRARADQPFGFLTSAGCSSFGYGIPAAIGPDQPTFLIAG
1jnrB           ----------------------------------------------------------------------
1kqfB1          ----------------------------------------------------------------------
1iqzA           ----------------------------------------------------------------------
2fug91          ----------------------------------------------------------------------
2v4jA1          ----------------------------------------------------------------------
1dtwA           ---------------------------------------------PLATQIPQAVGAAYAANRVVICYFG
1bluA           ----------------------------------------------------------------------
1um9A           ----------------ADPNKGRQMPEHPGSKALNFFTVASPIASHVPPAAGAAISMKLLRTGVAVCTFG
1ozfA3          ------------------MGSFHIWIARYLYTFRARQVMISNGQQTMGVALPWAIGAWLVNPEKVVSVSG
2v4jB1          ----------------------------------------------------------------------
1a6lA           ----------------------------------------------------------------------
1gt8A1          ----------------------------------------------------------------------
1h98A           ----------------------------------------------------------------------
1nekB1          ----------------------------------------------------------------------
1ovmA3          -----------------------IILADQGTSAFGAIDLRLPLWGSIGYTLAAAFGAQTACNRRVIVLTG
1c4aA3          ----------------------------------------------------------------------
1xerA           ----------------------------------------------------------------------
1gt8A5          ----------------------------------------------------------------------
1l8aA1          ---------------------------------------------SMGLGPIGAIYQAKFSKQTVYAFLG
1bfdA3          ------GRLHPETVFDTLNDMAPIYLNESTSTTAQMWQNMRNPGSYYFCAAG-GLGFALEPERQVIAVIG
1ti2B2          ----------------------------------------------------------------------
1b0pA5          ----------------------------------------------------------------------
2c31A3          ----------MLANPDISLVNEGANALDNTRMIVDMLKPRKRLDSVMGIGMGYCVAAAAVTGKPVIAVEG
2c31A2          ---------------------------------------------HEQHAGYAASIAGYIEGKPGVCLTV
2fug34          ----------------------------------------------------------------------
2akjA3          ----------------------------------------------------------------------
1jscA2          ---------------------------------------------HEQGAGHMAEGYARASGKPGVVLVT
1fxdA           ----------------------------------------------------------------------
1upaA2          --------------------------------------------RHEFTAGVAADVLARITGRPQACWAT
1bfdA2          --------------LLRRQGIDTVF-GNPGSNELPFLKDFPEDFRQEACVVGIADGYAQASRKAFINLHS
1powA2          ------------------------------------------------------AADAKLTGKIGVCFGS
1c7sA2          ---------------------------------------------DNRAGENGVDCAALGCNRVLFTLSN
1ozfA2          ---------------------------------------------HEANAAFMAAAVGRITGKAGVALVT
1dtwB2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DSTFYHAVLPQLVDIATRSVPILIVVMDNAYTAMTGGQPSPSRAIPAERITEAFGISTFVIDPIDVKKSV
1ni4A           DGAANQGQIFEYNXAALWKLPCIFICENNRYGXGTSVERAAA---STDYYKRGDFIPGLRVDGXDILCVR
1durA           ----------------------------------------------------------------------
1b0pA2          DGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAAAGKRTVYVATVSMGYSK
1hfeL2          ----------------------------------------------------------------------
1zpdA3          DGSFQLT-AQEVAQMVRLKLPVIIFLINNYGYTIEVMIHDGPYNNIKAGLMEVFNGNGGYDSGLKAKTGG
1kf6B1          -------------------------------------------------------------IKPYIIGNS
1powA3          DGGASM-TMQDLATQVQYHLPVINVVFTNCQYGFIKDEQEDTNQNDFSKIADGVHMAFRVNKIEQLP---
2gmhA3          ----------------------------------------------------------------------
1jb0C           ----------------------------------------------------------------------
1upaA3          DGGFHSN-SSDLETIARLNLPIVTVVVNNDTNGLIELYHDPAVKFGGVDFVALAANGVDATRATNREELL
1jnrB           ----------------------------------------------------------------------
1kqfB1          --------------------------------------SATNSITPPSQVRDYKAEVAKLIDVIGCKACQ
1iqzA           ----------------------------------------------------------------------
2fug91          ----------------------------------------------------------------------
2v4jA1          ----------------------------------------------------------------------
1dtwA           EGAASEGDAHAGFNFAATECPIIFFCRNNGYAISTPTSEQYR-GDGIAARGPGYGIMSIRVDGNDVFAVY
1bluA           ----------------------------------------------------------------------
1um9A           DGATSEGDWYAGINFAAVQAPAVFIAENNFPTIADK--------------AHAFGIPGYLVDGMDVLASY
1ozfA3          DGGFLQS-SMELETAVRLKANVLHLIWVDNGYNMVAIQEEKKYQRLSKAYAESFGAKGFAVE--SAEALE
2v4jB1          ----------------------------------------------------------------------
1a6lA           ----------------------------------------------------------------------
1gt8A1          ----------------------------------------------------------------------
1h98A           ----------------------------------------------------------------------
1nekB1          ----------------------------------------------------------------------
1ovmA3          DGAAQLT-IQELGSMLRDKQHPIILVLNNEGYTVERAIHGAIALWNWTHIPQALSL-DPQSECWRVSEAE
1c4aA3          ----------------------------------------------------------------------
1xerA           ----------------------------------------------------------------------
1gt8A5          ----------------------------------------------------------------------
1l8aA1          DGEMDEPSKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIINLEGIFEGAGWVIKVMWGSRWDELL
1bfdA3          DGSANYS-ISALWTAAQYNIPTIFVIMNNGTYGALRWFAGVLEAENVPGLDVAKGYGVQALKADNLEQLK
1ti2B2          ----------------------------------------------------------------------
1b0pA5          ----------------------------------------------------------------------
2c31A3          DSAFGF-SGMELETICRYNLPVTVIIMNNGGIYKGNEADPQPGVISCTRLTEAFGGKGYVANPAELKAAL
2c31A2          SAPGFLNGVTSLAHATTNCFPMILLSGSSEREIVDLQQGDYE-EMDQMNVARP--HCKASFRINSIKDIP
2fug34          ----------------------------------------------------------------------
2akjA3          ----------------------------------------------------------------------
1jscA2          SGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVGISR-----SCTKWNVMVKSVEELP
1fxdA           ----------------------------------------------------------------------
1upaA2          LGPGXTNLSTGIATSVLDRSPVIALAAQSESHDIFPND-----THQCLDSVAIVAXSKYAVELQRPHEIT
1bfdA2          AAGTGNAM-GALSNAWNSHSPLIVTAGQQTRAMI--GVEALLTNVDAANLPRPL--VKWSYEPASAAEVP
1powA2          AGPGGTHLMNGLYDAREDHVPVLALIGQFGTTGMNTFQEMNENPI-------YADVADYNVTAVNAATLP
1c7sA2          DGQAIDGKDWVIYFHS---PRQTLRVDNDQFKIHLTGDLYKLEPTAKFSGFPAGKAVEIPVVAEYW-QLF
1ozfA2          SGPGCSNLITGMATANSEGDPVVALGGAVKRADKAKQVHQSMDTVAMFS-----PVTKYAIEVTAPDALA
1dtwB2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EIIKKAVEIVKSGRPAVVVSRRPCALIGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDR
1ni4A           EATRFAAAYCRSGKGPI-----------------------------------------------------
1durA           -------------------------------------------VINDSCIACGACKPECPVNCIQE--GS
1b0pA2          QQFLKVLKAESFPGPSLVIAYATCI-NQGLRKGMGKSQDVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLD
1hfeL2          ----------------TVMERIEYEMHTPDPKAD-PDKLHFVQIDEAKCIGCDTCSQYCPTAAIFGEMGE
1zpdA3          ELAEAIKVLANTDGPTLI----------------------------------------------------
1kf6B1          RTADQGTNIQTPAQMAKYHQFSGCINCGLCAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQL
1powA3          DVFEQAKAIAQHE-PVLI----------------------------------------------------
2gmhA3          ---------------SVALSGTNHEHDQPAHLTLKD---DSVPVNRNLSIYDGPEQRFCPAGVYEFVPLF
1jb0C           -------------------------------------------KIYDTCIGCTQCVRACPTDVLEMVPQI
1upaA3          AALRKGAE---LGRPFLIEVPVNY----------------------------------------------
1jnrB           -------------------------------------------VNPEKCDGCKALERTADLMTLDKEKMK
1kqfB1          VACSEWNDIRDEVGHCVGVYDNPADLSAKSWTVSETEQNGKWLIRKDGCMHCEDPGCLKACPAIIQYANG
1iqzA           ---------------------------------------PKYIVDKETCIACGACYDEDGIAYVTDDNQG
2fug91          ----------------------PDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAAENPVSAGERYAK
2v4jA1          ------------------------AVKAYVAGEFKPNAGAHSGRDWGKFDIEAEVVNRCPSKCMK-WDGS
1dtwA           NATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRHPISRLRHYLLSQGWWD--------------
1bluA           -------------------------------------------MITDECINCDVCEPECPNGA-ISQGDE
1um9A           YVVKEAVEARRGEGPSLV----------------------------------------------------
1ozfA3          PTLRAAMD---VDGPAVVAIPVDY----------------------------------------------
2v4jB1          ---------------------------------------MIDHEWTDQLCEIPLAVASCPTAAVRPTKVN
1a6lA           -------------------------------------------VVTDNCIKCKYCDCVEVCPVCFYEGPN
1gt8A1          --------------------TSISNKNYYGAAKMIFSDNPLGLTCGMVCPTSDLCVGGCNLYATEGGLQQ
1h98A           -------------------------------------------VICEPCIGVKDQSCVEVCPVCIYDGGD
1nekB1          ----------------------NNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWSRLDGL
1ovmA3          QLADVLEKVAHHERLSLI----------------------------------------------------
1c4aA3          ------------------------------KTEYVDERSKSLTVDRTKCLLCGRCVNACGKNTEIIGAED
1xerA           ---------------------------------------TIVGVDFDLCIADGSCINACPVNVFQASEKK
1gt8A5          ---------------------------------------VVAVIDEEMCINCGKCYMTCNDSGYQAIQFD
1l8aA1          RKDTSGKLIQ------------------------------------------------------------
1bfdA3          GSLQEALS---AKGPVLI----------------------------------------------------
1ti2B2          --------------------------------------------------------------AVYQREDG
1b0pA5          -------------KEEELVGAPANFTALEAKGKELKGYKFRIQINTLDCMGCGNCADICPPKEKA-LVMQ
2c31A3          E------EAVASGKPCLI----------------------------------------------------
2c31A2          IGIARAVRTAVSGRPGGVYVDLP-----------------------------------------------
2fug34          ---------------------------------------PFVILDRERCIHCKRCVRYFEEVPGDEVLDF
2akjA3          ------------------------------------------------SCGQVQVADIGFMGCMTRDENG
1jscA2          LRINEAFEIATSGRPGPVLVDLP-----------------------------------------------
1fxdA           -------------------------------------------EVNDDCMAXEACVEICPDVFEMNEEGD
1upaA2          DLVDSAVNAAXTEPVGPSF---------------------------------------------------
1bfdA2          HAMSRAIHMASMAPQGPVY---------------------------------------------------
1powA2          HVIDEAIRRAYAHQGVAVV---------------------------------------------------
1c7sA2          RNDFLPRWYATGDAKPKMLAN-------------------------------------------------
1ozfA2          EVVSNAFRAAEQGRPGSAF---------------------------------------------------
1dtwB2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KAHVDPALCVGCGICAEVCPFNAFKPEGKREAWLELWRQA
1ni4A           ----------------------------------------
1durA           IYAIDADSCIDCGSCASVCPVGAPNPE-------------
1b0pA2          SK--------------------------------------
1hfeL2          PSIPHIEACINCGQCLTHCPENAIY---------------
1zpdA3          ----------------------------------------
1kf6B1          NSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDF
1powA3          ----------------------------------------
2gmhA3          RLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYN--
1jb0C           ASSPRTEDCVGCKRCETACPTDFLSIRVYLGA--------
1upaA3          ----------------------------------------
1jnrB           AYNREPDMCWECYSCVKMCPQGAIDVRGYVD---------
1kqfB1          IVDFQSENCIGCGYCIAGCPFNILNKEDNR----------
1iqzA           IVEVPDILIDDMMDAFEGCPTDSIKVA-DEPFDGDPN---
2fug91          VYEINMLRCIFCGLCEEACPTGAIVLGYDFE---------
2v4jA1          KLSIDNKECVRCMHCINTMPRAL-----------------
1dtwA           ----------------------------------------
1bluA           TYVIEPSLCTECSQCVEVCPVDCIIKDPSHE---------
1um9A           ----------------------------------------
1ozfA3          ----------------------------------------
2v4jB1          TIAIKNERCMYCGNCYTMCPALPIS---------------
1a6lA           FLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQ-----
1gt8A1          FASEVFKAMNIPQIRNPCLPSQEKMP--------------
1h98A           QFYIHPEECIDCGACVPACPVNAIYPEEDVPEQWK-----
1nekB1          SDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQR-
1ovmA3          ----------------------------------------
1c4aA3          EKCFDDTNCLLCGQCIIACPVAALS---------------
1xerA           ADPVNEQACIFCMACVNVCPVAAVKP--------------
1gt8A5          PETTVTDTCTGCTLCLSVCPIIDCIRMVSRT---------
1l8aA1          ----------------------------------------
1bfdA3          ----------------------------------------
1ti2B2          IVLIDPEKAKGKKELLDTCPYGVWNEEENV----------
1b0pA5          PLDTQRDAQVPNLEYAARIP--------------------
2c31A3          ----------------------------------------
2c31A2          ----------------------------------------
2fug34          GTMDFGLPSGFSGNITDICPVGALLDLTARFRA-------
2akjA3          KPCEGADVFVGGRIGSDSHLGDIYKKAVPCK---------
1jscA2          ----------------------------------------
1fxdA           KAVVNPDSDLDCVEAIDSCPAEA-----------------
1upaA2          ----------------------------------------
1bfdA2          ----------------------------------------
1powA2          ----------------------------------------
1c7sA2          ----------------------------------------
1ozfA2          ----------------------------------------
1dtwB2          ----------------------------------------