[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL64972.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gdtA2.bssp"
#ERROR : Can't open dsspfile "2qmmA1.bssp"
#ERROR : Can't open dsspfile "2oa4A1.bssp"

## Summary of PDB Search
:251
    3e-18  26%  1gdtA2 [c.53.1.1] PROTEIN (GAMMA DELTA RESOLVASE) A:1 -- 140
    1e-13  12%  2qmmA1 [c.116.1.7] UPF0217 PROTEIN AF_1056 A:95 -- 288
    1e-06  13%  2oa4A1 [a.4.12.3] SIR5 A:1 -- 93
:251

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxYIRVSTEEQDPENQRVFLERWAGERGIYIVKHYVDVGVSGATEPWERPAFRQMASEVDKLEPRP
1gdtA2          ------YARVSTSQQSLDIQVRALK----DAGVKANRIFTDKA-SGSSS--DRKGLDLLRMKVEEGD---
2qmmA1          --------RMSPDERNVAGHIKKALAVE-------CGKSWKKVHSGVYV--SRKGLEELI----EELSEK
2oa4A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RVLLVYEISRLVRSFQELFTLLDVVENRLGLVVVSASEREQALQNLDGVYRQFLRAVLAFVATMEREFIR
1gdtA2          -VILVKKLDRLGRDTADMIQLIKEFDAQ-GVSIRFIDDGI----STDGEMGKMVVTILSAVAQAERQRIL
2qmmA1          YSIIYLKEDGVDISNAQLPPNPLFVIGD-HEGLTEEQEKRYAALKLSLSPLSLLAEQCVVIAHHHLDRL-
2oa4A1          --------------------------------------------------------MFLRKVEGPRSVTL


                         +         .         .         .         .         *         .:210
query           QRTKTALERARLQGKVWNVAEKRRDLTQAVVEMYLSGASLRETARAFGLSLYEVRRILxxxxxxxxxxxx
1gdtA2          ERTNEGRQEAMAKGVV------------------------------------------------------
2qmmA1          ----------------------------------------------------------------------
2oa4A1          PDGSIMTRADLPPANTRRWVASRK--IAVVRGVIYGLITLAEAKQTYGLSDEEFNSWV------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1gdtA2          -----------------------------------------
2qmmA1          -----------------------------------------
2oa4A1          -----------------------------------------