[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL65054.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1h65A.bssp"
#ERROR : Can't open dsspfile "1nrjB.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1f6bA.bssp"
#ERROR : Can't open dsspfile "1xzpA1.bssp"
#ERROR : Can't open dsspfile "1egaA1.bssp"
#ERROR : Can't open dsspfile "1xzpA2.bssp"
#ERROR : Can't open dsspfile "1ahjB.bssp"
#ERROR : Can't open dsspfile "2fh5B1.bssp"
#ERROR : Can't open dsspfile "1sulA.bssp"
#ERROR : Can't open dsspfile "1lnzA2.bssp"
#ERROR : Can't open dsspfile "1z2cB1.bssp"
#ERROR : Can't open dsspfile "1zd9A1.bssp"
#ERROR : Can't open dsspfile "121pA.bssp"
#ERROR : Can't open dsspfile "1a2kC.bssp"
#ERROR : Can't open dsspfile "1wdtA2.bssp"
#ERROR : Can't open dsspfile "1puiA.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "1wxqA1.bssp"
#ERROR : Can't open dsspfile "1aipA3.bssp"
#ERROR : Can't open dsspfile "2bmjA1.bssp"
#ERROR : Can't open dsspfile "1e0sA.bssp"
#ERROR : Can't open dsspfile "2cxxA1.bssp"
#ERROR : Can't open dsspfile "1dioA.bssp"
#ERROR : Can't open dsspfile "1h2tC3.bssp"
#ERROR : Can't open dsspfile "1mkyA2.bssp"
#ERROR : Can't open dsspfile "1darA2.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "1tpzA.bssp"

## Summary of PDB Search
:346
    2e-15  15%  1h65A  [c.37.1.8] CHLOROPLAST OUTER ENVELOPE PROTEIN OEP34
    5e-13  14%  1nrjB  [c.37.1.8] SIGNAL RECOGNITION PARTICLE RECEPTOR BETA
    1e-10  19%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    1e-10  12%  1f6bA  [c.37.1.8] SAR1
    2e-10  11%  1xzpA1 [a.24.25.1] PROBABLE TRNA MODIFICATION GTPASE TRME A:118 --
    1e-09  17%  1egaA1 [c.37.1.8] PROTEIN (GTP-BINDING PROTEIN ERA) A:4 -- 182
    2e-09  25%  1xzpA2 [c.37.1.8] PROBABLE TRNA MODIFICATION GTPASE TRME A:212 --
    6e-09  15%  1ahjB  [b.34.4.4] NITRILE HYDRATASE (SUBUNIT BETA)
    9e-09  15%  2fh5B1 [c.37.1.8] SIGNAL RECOGNITION PARTICLE RECEPTOR BETA B:63 --
    1e-08  15%  1sulA  [c.37.1.8] GTP-BINDING PROTEIN YSXC
    1e-08  23%  1lnzA2 [c.37.1.8] SPO0B-ASSOCIATED GTP-BINDING PROTEIN A:158 -- 342
    2e-08   9%  1z2cB1 [a.118.1.23] DIAPHANOUS PROTEIN HOMOLOG 1 B:83 -- 443
    2e-08  11%  1zd9A1 [c.37.1.8] ADP-RIBOSYLATION FACTOR-LIKE 10B A:18 -- 181
    3e-07  20%  121pA  [c.37.1.8] H-RAS P21 PROTEIN
    5e-07  16%  1a2kC  [c.37.1.8] RAN
    1e-06  15%  1wdtA2 [c.37.1.8] ELONGATION FACTOR G HOMOLOG A:8 -- 274
    3e-06  11%  1puiA  [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGB
    2e-05  15%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    2e-05  27%  1wxqA1 [c.37.1.8] GTP-BINDING PROTEIN A:1 -- 319
    2e-05  21%  1aipA3 [c.37.1.8] ELONGATION FACTOR TU A:9 -- 212
    5e-05  17%  2bmjA1 [c.37.1.8] CENTAURIN GAMMA 1 A:66 -- 240
    1e-04  11%  1e0sA  [c.37.1.8] ADP-RIBOSYLATION FACTOR 6
    1e-04  14%  2cxxA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGB A:2 -- 185
    3e-04  11%  1dioA  [c.1.19.3] PROTEIN (DIOL DEHYDRATASE)
    5e-04   3%  1h2tC3 [a.118.1.14] 80 KDA NUCLEAR CAP BINDING PROTEIN C:481 -- 790
    5e-04  18%  1mkyA2 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:173 -- 358
    6e-04  31%  1darA2 [c.37.1.8] ELONGATION FACTOR G A:1 -- 282
    6e-04  21%  1eg7A  [c.37.1.10] FORMYLTETRAHYDROFOLATE SYNTHETASE
    8e-04  19%  1tpzA  [c.37.1.8] INTERFERON-INDUCIBLE GTPASE
:346

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGKAIASILREMALRMP
1h65A           ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f6bA           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1z2cB1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1wxqA1          ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
2bmjA1          ----------------------------------------------------------------------
1e0sA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1dioA           ------------------------------------------------------FDLIDHFIARYGINLN
1h2tC3          ----------------------------------------------------------------------
1mkyA2          ----------------------------------------------------------------------
1darA2          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FLDRLHPFYRELIDAVIGARAYKHVVAKVGNANLAVKAIAKEAITAVRTAPDKKALLDARRMYKARIIDL
1h65A           ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f6bA           ----------------------------------------------------------------------
1xzpA1          -------------------------------LKLSLRNLKGGLRDFVDSLRRELIEVLAEIRVPDEIETN
1egaA1          ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
1ahjB           ------------------------SLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATL
2fh5B1          ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1z2cB1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1wxqA1          ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
2bmjA1          ----------------------------------------------------------------------
1e0sA           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1dioA           VMAMDPNVKRSEIVPLTTAMTPAKIVEVVSHMNVVEMMMAMQKMRARRTPSQQAHVTNVKDN---PVQIA
1h2tC3          ----------------------------------------------------------------------
1mkyA2          ----------------------------------------------------------------------
1darA2          ----------------------------------------------------------------------
1eg7A           ---------------------------------------------AQAAKMKPVMELARGLGIQEDEVEL
1tpzA           --------------------------------NTGRKIISQEILNLIELRMRKGNIQLTNSAISD-ALKE


                         +         .         .         .         .         *         .:210
query           LNDLRPELEKMREIVVFLRKLPSIDPELFTIVVAGAPNVGKSSFVRCVSTAKPEVAEYPFTTKQIHLGHI
1h65A           -------------LLELLGNLKQEDVNSLTILVXGKGGVGKSSTVSIIGERVVSISPFQSEGPRPVXVSR
1nrjB           ---------------------------QPSIIIAGPQNSGKTSLLTLLTTDSVR----PTVVSQEPLSAA
1ni3A1          ----------------------------LKTGIVGXPNVGKSTFFRAITKSLGNPANYPYATIDPEEAKV
1f6bA           ---------------------------TGKLVFLGLDNAGKTTLLHMLKDDPTLHPTSEELTIAGMTFTT
1xzpA1          TGEVVTRLERIKEKL--TEELKKADAGILLNRGQEIFERGSDSLITNL-RQKQLLENVKGHLED--AIKS
1egaA1          ---------------------------CGFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGI
1xzpA2          ----------------------------LRMVIVGKPNVGKSTLLRLLNEDRAIVTDIPGTTRDVISEEI
1ahjB           MVEKGILTQDELESLAGGPSRPSESEGRPAPVETTTFEVGQRVRVRDEY--VPGHIRMPAYCRGRVGTIS
2fh5B1          ------------------------------VLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVN
1sulA           ------KVTKSEIVISAVKPEQYPEGGLPEIALAGRSNVGKSSFINSLINRKNLAQTLNFYIINDELHFV
1lnzA2          ---------------------------LADVGLVGFPSVGKSTLLSVVSSAKPKIADYHFTTLVPNLGXV
1z2cB1          ------------------NMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSG
1zd9A1          ----------------------------MELTLVGLQYSGKTTFVNVIASGQFNEDMIPTGFNMRKITKG
121pA           ----------------------------YKLVVVGAGGVGKSALTQLIQNHFVD--EYDPTIEDSYRKQV
1a2kC           ----------------------------FKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVF
1wdtA2          -----------------------------TVALVGHAGSGKTTLTEALLYKTGAKTDYTPEAKLHRTTVR
1puiA           -----------------------------SAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQQLINL
1mkyA1          ------------------------------VLIVGRPNVGKSTLFNKLVKDPVQDTVEWYGKTFKLVDTC
1wxqA1          --------------------------------VVGKPNVGKSTFFSAATLANVAITDHPCKELGCXVDVA
1aipA3          ------------------------------VGTIGHVDHGKTTLTAAVTAAENPTAHVEYETAKRH----
2bmjA1          ----------------------------LRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQYKKEMLV
1e0sA           ---------------------------EMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYK
2cxxA1          -----------------------------TIIFAGRSNVGKSTLIYRLTGKKV-RRGKRPGVTRKIIEIE
1dioA           ADAAEGAWRGFDEQETTVAVARYAPFNAIALLVGSQ----------------------------------
1h2tC3          ----------------------------------------------------------------------
1mkyA2          ---------------------------AIKVAIVGRPNVGKSTLFNAILNKERALVSPIPVDDEVFIDGR
1darA2          ---------------------------------------------------------------------C
1eg7A           YGKYKAKI--SLDVYRRLKDKPDGKLILVTAITPTPAGEGK-------------------TTTSVGLTDA
1tpzA           IDSSV-----------------------LNVAVTGETGSGKSSFIRGIGNEEEGAAKTGVVEVTME-RHP


                         .         .         .         +         .         .         .:280
query           FLRGDRVQVIDTPGLLDRPLSERNQIEKQAILALRHLAGVIVFVVDPTPHSGYSLEMQERLWREIKEGFS
1h65A           SRAGFTLNIIDTPGLIEGGYINDXALNIIKSFLLDKTIDVLLYVDRLDRVDNLDKLVAKAITDSFGKGIW
1nrjB           DYDGSGVTLVDFPGHVKLRYKLSDYLKTRAKFVKGLIFMVDSTVDPKKLTTTAEFLVDILSITESSCENG
1ni3A1          AVPDERFDWLCEAYKPKSRVPAFLTVFDIAGLGLGNAFLSHVRAVDAIYQVVRAFDDAEIIHVEGDVDPI
1f6bA           FDLGGRRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERL
1xzpA1          LKEGMPVDMASIDLERALNLLDEVTGRSFREDLLDTIFSNFC----------------------------
1egaA1          HTEGAYQAIYVDTPGLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPDDEMVLN----KLREGK
1xzpA2          VIRGILFRIVDTAGVRSETNDLVERLGIERTLQEIEKADIVLFVLDASSP---LDEEDRKILERIKN-KR
1ahjB           HRTTEKWPFPDAIGHNDAGEEPTYHVKFAAEELFGSDTDGGSVVVD------------------------
2fh5B1          NNRGNSLTLIDLPGHESLRFQLLDRFKSSARAVV-----FVVDSAAFQREVKDVAEFLYQIDSMALKN-S
1sulA           DVPGYGFAKV------SKSEREAWGRMIETYITTREELKAVVQIVDLRHAPSNDDVQMYEFLKYYG----
1lnzA2          ETDDGRSFVXADLPGLIEGAHQGVGLGHQFLRHIERTRVIVHVIDXSGLEGRDPLTINQELSEYNLRLTE
1z2cB1          TSIALKVCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQELREIENE---DMKVQLCVFDEQGD---
1zd9A1          NVTIKLWDIGGQPRFRSMWERYC-----------RGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQG
121pA           VIDGETCDILDTAGQEEYSAMRDQYMRT---------GEGFLCVFAINTKSFEDIHQYREQIKRVKDSDD
1a2kC           HTNRGPIKFN----VWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYK----NVPNWHRDLVRVCEN
1wdtA2          TGVAPLLFRGHRVFLLDAPGYGDFVGE--IRGALEAADAALVAVSAEAGVQVGTERAWTVAERLGL----
1puiA           FEVADGKRLVDLPGGEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDIEWAVDSNIAVLVLLTKA
1mkyA1          GVFDNPQDIISQKXKEVTLNXIREAD-------------LVLFVVDGKRGITKEDESLADFLRKST----
1wxqA1          FLDDLRIHVVDATGKTDPPVEDIEFLEREIDYWAEHLSGIGVNENDPEDPTKWSQDDLLAFASEIRR-VN
1aipA3          ------YSHVDCPGHADYI--------KNMITGAAQMDGAILVVSAADGPMPQT----REHILLARQVGV
2bmjA1          DGQTHLVLIREEAGAPDAKFSGWADAV---------IFVFSLEDEN-------SFQAVSRLHGQLSRGRG
1e0sA           NVKFNVWDVGGQDKIRPLWRHYYTG---------TQGLIFVVDCADRDRIDEARQELHRIINDREMR--D
2cxxA1          WKNHKIIDXPGFGFXXGLPKEVQERIKDEIVHFIEDNAKNIDVAVLVVDWEKRGEIPIDVEFYQFLRELD
1dioA           ----------------------------------------------------------------------
1h2tC3          ------------------------------------------YGDESSNSLPGHSVALCLAFKSKATND-
1mkyA2          KYVFVDTAGLEKYSNYRVVDSIEKADV-------------VVIVLDATQGITRQDQLXERRGRAS-----
1darA2          FWKDHRINIIDTPGHVD--------FTIEVERSMRVLDGAIV-VFDSSQG----VEPQETVWRQAEK-YK
1eg7A           LARGKRVMVCLSFGIKVVPMEDINLHFTGDIHAVTYAHNLLAAMVDNHLQQGNVLNIDPRTWRRVID---
1tpzA           YKHPNIPNVVDLPGIGSTNFPPDTYLEK------------------------------------------


                         .         *         .         .         .         .         +:350
query           APAVAVLNKIDIATEEELEKARAIFAPIGEISTLNCRGTKEVMDYVLQKYYVPAALEKLRAAARGR
1h65A           NKAIVALTHAQFSPPDGLDEFFSKRSEALLQVVRSGASLKKDAQASDIPVVLIENSGRCNKNDSDE
1nrjB           IDILIACNKSELFTARPPSERRKKSLNELDVLGFKFANLEASVVAFEGSINKRKISQWREW-----
1ni3A1          RDLSIIVDELLIKDAEFVEKHLEGL-----------------------------------------
1f6bA           REMFGLYGQTTGKGSVSLKELNARPLEVFMCSVLKRQGYGEGFRWMAQY-----------------
1xzpA1          ------------------------------------------------------------------
1egaA1          APVILAVNKVDLLPHLQFLASQMNFLDIVPISAETGLNVDTIAAIVRKHLPEA-------------
1xzpA2          YL--VVINKVDVVNEEEIKNKLGTDRHMVKISALKGEGLEKLEESIYR------------------
1ahjB           ------------------------------------------------------------------
2fh5B1          PSLLIACNKQDIAMAQQQLEKELNTLRVTRSPAQLGKKGKEFEFSQL-------------------
1sulA           IPVIVIATKADKIKVVRQTLNIDPEDELILFSSETKKGKDEAWGAIKKMIN---------------
1lnzA2          RPQIIVANKXDAENLEAFKEKLTDDYPVFPISAVTREGLRELLFEVANQ-----------------
1z2cB1          EDFFDLKGRLD-------------------------------------------------------
1zd9A1          IPVLVLGNKRDLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQH-----------------
121pA           VPMVLVGNKCDVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVRE-----------------
1a2kC           IPIVLCGNKVDIVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPA---
1wdtA2          -PRMVVVTKLDKGGDLRSTLGPILPIDLPLYEGGKWVGLIDVFHGKAYRYE---------------
1puiA           DKLASGARKAQLNMVREAVLAFNGDVQVETFSSLKKQGVDKLRQKLDTWF----------------
1mkyA1          VDTILVANKAENLREVKPELYSLGFGEPIPVSAEHNINLDTXLETIIKKLEEKGLDLE--------
1wxqA1          KPXVIAANKADAASDEQIKRLVREEEKRG-------------------------------------
1aipA3          PYIVVFMNKVDMVDDPE-------------------------------------------------
2bmjA1          GLALAVGTQDRGDARARALCADMKRCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQL-------
1e0sA           AIILIFANKQDLPDAMKLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSN-----------------
2cxxA1          IPTIVAVNKLDFLAEKFEVPLSEIDKVFIPISAKFGDNIERLKNRIFEV-----------------
1dioA           ------------------------------------------------------------------
1h2tC3          -EIFSILKDVPNPSFNP-LKIEVFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAESDEGKLHVLR-
1mkyA2          ---VVVFNKWDLVVHREKRYYFIDYSPLIFTSADKGWNIDRXIDAXNLAY----------------
1darA2          VPRIAFANKMDKTGADLWLVIRTMQERLG-------------------------------------
1eg7A           ------------------------------------------------------------------
1tpzA           ------------------------------------------------------------------