[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL65069.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1fg3A.bssp"
#ERROR : Can't open dsspfile "1c8nA.bssp"
#ERROR : Can't open dsspfile "1dtyA.bssp"
#ERROR : Can't open dsspfile "1vp4A.bssp"
#ERROR : Can't open dsspfile "1u08A.bssp"
#ERROR : Can't open dsspfile "1b5oA.bssp"
#ERROR : Can't open dsspfile "1bw0A.bssp"
#ERROR : Can't open dsspfile "2aeuA1.bssp"
#ERROR : Can't open dsspfile "1s2bA.bssp"
#ERROR : Can't open dsspfile "2gb3A1.bssp"
#ERROR : Can't open dsspfile "1b9hA.bssp"
#ERROR : Can't open dsspfile "1xl7A1.bssp"
#ERROR : Can't open dsspfile "1agxA.bssp"
#ERROR : Can't open dsspfile "1lc5A.bssp"
#ERROR : Can't open dsspfile "2igsA1.bssp"
#ERROR : Can't open dsspfile "1h1cA.bssp"
#ERROR : Can't open dsspfile "1gbnA.bssp"
#ERROR : Can't open dsspfile "1fc4A.bssp"
#ERROR : Can't open dsspfile "1cs1A.bssp"
#ERROR : Can't open dsspfile "2cfbA1.bssp"
#ERROR : Can't open dsspfile "1w9gA1.bssp"
#ERROR : Can't open dsspfile "1aamA.bssp"
#ERROR : Can't open dsspfile "1vk9A.bssp"
#ERROR : Can't open dsspfile "2bwnA1.bssp"
#ERROR : Can't open dsspfile "1v72A1.bssp"
#ERROR : Can't open dsspfile "1fhlA.bssp"
#ERROR : Can't open dsspfile "1mdoA.bssp"
#ERROR : Can't open dsspfile "1nc7A.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"
#ERROR : Can't open dsspfile "1m32A.bssp"
#ERROR : Can't open dsspfile "2e7iA1.bssp"
#ERROR : Can't open dsspfile "1vefA1.bssp"
#ERROR : Can't open dsspfile "1d2fA.bssp"
#ERROR : Can't open dsspfile "1iugA.bssp"
#ERROR : Can't open dsspfile "1c7nA.bssp"
#ERROR : Can't open dsspfile "1wytB1.bssp"
#ERROR : Can't open dsspfile "1ecxA.bssp"
#ERROR : Can't open dsspfile "1cl1A.bssp"
#ERROR : Can't open dsspfile "2govA1.bssp"
#ERROR : Can't open dsspfile "1ohvA.bssp"
#ERROR : Can't open dsspfile "1m53A2.bssp"
#ERROR : Can't open dsspfile "1vjzA.bssp"
#ERROR : Can't open dsspfile "1qz9A.bssp"
#ERROR : Can't open dsspfile "2fn6A1.bssp"
#ERROR : Can't open dsspfile "1eh9A3.bssp"
#ERROR : Can't open dsspfile "2c0hA1.bssp"
#ERROR : Can't open dsspfile "1qnoA.bssp"
#ERROR : Can't open dsspfile "1px8A2.bssp"
#ERROR : Can't open dsspfile "1pmmA.bssp"
#ERROR : Can't open dsspfile "1ei7A.bssp"
#ERROR : Can't open dsspfile "1svvA.bssp"
#ERROR : Can't open dsspfile "1zy9A2.bssp"

## Summary of PDB Search
:315
    1e-15  21%  1fg3A  [c.67.1.1] HISTIDINOL PHOSPHATE AMINOTRANSFERASE
    8e-13  10%  1c8nA  [b.121.4.7] COAT PROTEIN
    4e-12  12%  1dtyA  [c.67.1.4] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    5e-12  20%  1vp4A  [c.67.1.1] AMINOTRANSFERASE, PUTATIVE
    8e-12  14%  1u08A  [c.67.1.1] HYPOTHETICAL AMINOTRANSFERASE YBDL
    4e-11  22%  1b5oA  [c.67.1.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    1e-10  18%  1bw0A  [c.67.1.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    4e-10  17%  2aeuA1 [c.67.1.8] HYPOTHETICAL PROTEIN MJ0158 A:9 -- 374
    4e-10   9%  1s2bA  [b.29.1.20] SCYTALIDOPEPSIN B
    1e-09  20%  2gb3A1 [c.67.1.1] ASPARTATE AMINOTRANSFERASE A:4 -- 392
    1e-09  18%  1b9hA  [c.67.1.4] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    2e-09   6%  1xl7A1 [c.43.1.3] PEROXISOMAL CARNITINE O-OCTANOYLTRANSFERASE A:11
    2e-09  10%  1agxA  [c.88.1.1] GLUTAMINASE-ASPARAGINASE
    2e-09  18%  1lc5A  [c.67.1.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    1e-08  12%  2igsA1 [d.2.1.11] HYPOTHETICAL PROTEIN A:4 -- 215
    1e-08  16%  1h1cA  [c.67.1.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    4e-08  11%  1gbnA  [c.67.1.4] ORNITHINE AMINOTRANSFERASE
    4e-08  13%  1fc4A  [c.67.1.4] 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE
    4e-08  20%  1cs1A  [c.67.1.3] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    5e-08  15%  2cfbA1 [c.67.1.4] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE A:19 --
    6e-08  14%  1w9gA1 [d.330.1.1] ENHANCER OF RUDIMENTARY HOMOLOG A:1 -- 103
    9e-08  17%  1aamA  [c.67.1.1] ASPARTATE AMINOTRANSFERASE
    9e-08  11%  1vk9A  [c.97.1.3] CONSERVED HYPOTHETICAL PROTEIN TM1506
    9e-08  11%  2bwnA1 [c.67.1.4] 5-AMINOLEVULINATE SYNTHASE A:2 -- 397
    1e-07  13%  1v72A1 [c.67.1.1] ALDOLASE A:6 -- 350
    2e-07  23%  1fhlA  [c.1.8.3] BETA-1,4-GALACTANASE
    3e-07  12%  1mdoA  [c.67.1.4] ARNB AMINOTRANSFERASE
    4e-07  13%  1nc7A  [b.123.1.1] HYPOTHETICAL PROTEIN TM1070
    4e-07  16%  1b8gA  [c.67.1.4] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    4e-07  14%  1m32A  [c.67.1.3] 2-AMINOETHYLPHOSPHONATE-PYRUVATE
    5e-07  16%  2e7iA1 [c.67.1.9] SEP-TRNA:CYS-TRNA SYNTHASE A:8 -- 371
    6e-07  14%  1vefA1 [c.67.1.4] ACETYLORNITHINE/ACETYL-LYSINE AMINOTRANSFERASE
    8e-07  16%  1d2fA  [c.67.1.3] MALY PROTEIN
    1e-06  13%  1iugA  [c.67.1.3] PUTATIVE ASPARTATE AMINOTRANSFERASE
    2e-06  15%  1c7nA  [c.67.1.3] CYSTALYSIN
    4e-06  17%  1wytB1 [c.67.1.7] GLYCINE DEHYDROGENASE SUBUNIT 2 (P-PROTEIN) B:2
    5e-06  12%  1ecxA  [c.67.1.3] AMINOTRANSFERASE
    6e-06  10%  1cl1A  [c.67.1.3] CYSTATHIONINE BETA-LYASE
    7e-06   6%  2govA1 [d.60.1.4] HEME-BINDING PROTEIN 1 A:7 -- 190
    8e-06  13%  1ohvA  [c.67.1.4] 4-AMINOBUTYRATE AMINOTRANSFERASE
    9e-06  18%  1m53A2 [c.1.8.1] ISOMALTULOSE SYNTHASE A:43 -- 520
    1e-05   9%  1vjzA  [c.1.8.3] ENDOGLUCANASE
    6e-05  14%  1qz9A  [c.67.1.3] KYNURENINASE
    7e-05  11%  2fn6A1 [c.67.1.4] AMINOTRANSFERASE A:2 -- 372
    1e-04  15%  1eh9A3 [c.1.8.1] GLYCOSYLTREHALOSE TREHALOHYDROLASE A:91 -- 490
    2e-04  12%  2c0hA1 [c.1.8.3] MANNAN ENDO-1,4-BETA-MANNOSIDASE A:18 -- 367
    3e-04  12%  1qnoA  [c.1.8.3] ENDO-1,4-B-D-MANNANASE
    3e-04   7%  1px8A2 [c.1.8.3] BETA-XYLOSIDASE A:14 -- 359
    3e-04  14%  1pmmA  [c.67.1.6] GLUTAMATE DECARBOXYLASE BETA
    4e-04  18%  1ei7A  [a.24.5.1] COAT PROTEIN
    5e-04  19%  1svvA  [c.67.1.1] THREONINE ALDOLASE
    6e-04  12%  1zy9A2 [c.1.8.13] ALPHA-GALACTOSIDASE A:178 -- 525
:315

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLIELYDIPRQNLAIVSGAQEGNFLAFLAVK
1fg3A           ------------------------------------------QYAGVKPEQVLVSRGADEGIELLIRACE
1c8nA           --------------------------------------------------NLTPIALAYTVQSLPLIATQ
1dtyA           --------------------------------------------KGEARDRFLTFRNGYHGDTFGAMSVP
1vp4A           -----------------------------------------------DEDNLIFTVGSQQALDLIGKLFL
1u08A           -----------------------------------------------ADSDITVTAGATEALYAAITALV
1b5oA           -----------------------------------------------------VTVGGSQALFNLFQAIP
1bw0A           --------------------------------------------------NVVLCSGGSHGILMAITAIC
2aeuA1          --------------------------------------------------KCVGFNRTSSAILATILALK
1s2bA           ------------------------------------------------------------GDTCQTAILQ
2gb3A1          -----------------------------------------------------VTNGGSEAILFSFAVIA
1b9hA           ---------------------------------------------------LAVTNGTHALELALQVMGV
1xl7A1          -----------------------------------------------YSIEDSSPHATPEEYSQVFEXLL
1agxA           ----------------------------------------------------------------------
1lc5A           ----------------------------------------LARHHQVPASWILAGNGETESIFTVASGLK
2igsA1          ----------------------------------------------------------------------
1h1cA           ----------------------------------------------------KNNVSVGNGADEIIYVXX
1gbnA           ----------------------------------------------------------------------
1fc4A           -----------------------------------------------------LYSSCFDANGGLFETLL
1cs1A           -----------------------------------------------------LTNTGMSAIHLVTTVLK
2cfbA1          -------------------------------------------------------TEACMAVLRLMRAYT
1w9gA1          ----------------------------------------------------------------------
1aamA           ----------------------------------------------------------------------
1vk9A           ----------------------------------------------------------------------
2bwnA1          -----------------------------------------------------VFSSAYNANDATLSTLL
1v72A1          ----------------------------------------------------------------------
1fhlA           ----------------------------------------------------------------------
1mdoA           ----------------------------------------FCRLTGNQYAVA-VSSATAGXHIALXALGI
1nc7A           ----------------------------------------------------------------------
1b8gA           -------------------------------------------KVTFDPNHLVLTAGATSANETFIFCLP
1m32A           ----------------------------------------------------------------------
2e7iA1          -----------------------------------------------------VTNGAREAKFAVMLAKK
1vefA1          ------------------------------------------AILPPELNRVFPVNSGTEANEAALKFAR
1d2fA           -----------------------------------------------------YGPSVIYMVSELIRQWS
1iugA           ----------------------------------------LREAFRTEGEVLILTGSGTLAMEALVKNLF
1c7nA           --------------------------------------------WDIQTDWIINTAGVVPAVFNAVREFT
1wytB1          ----------------------------------------LKALTGMDAITLEPAAGAH-GELTGILIIR
1ecxA           ----------------------------------------VAKVLGVSPSEIFFTSCATESINWILKTVR
1cl1A           ----------------------------------------------------------------------
2govA1          --------------------------------------------------------------LKVWFRIP
1ohvA           ----------------------------------------------------------------------
1m53A2          ----------------------------------------------------------------------
1vjzA           ----------------------------------------------------------------------
1qz9A           -------------------------------------------LIGARDGEVVVTDTTSINLFKVLSAAL
2fn6A1          -----------------------------------------------------VFNSATSALLTLYRNFS
1eh9A3          ----------------------------------------------------------------------
2c0hA1          ----------------------------------------------------------------------
1qnoA           ----------------------------------------------------------------------
1px8A2          ----------------------------------------------------------------------
1pmmA           ----------------------------------------------------------------------
1ei7A           ----------------------------------------------------------------------
1svvA           -----------------------------------------------------FISGGTQTNLIACSLAL
1zy9A2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PEYAVITVPEYEPIIKLPSSLGVRHVKVWDVWEAPIKPGGVLIFSNPNNPTGRYLEKRELAELADEARRK
1fg3A           PGKDAILYCPYGXYSVSAETIGVECRTVLQGISDKLDGVKVVYVCSPNNPTGQLINPQDFRTLLELTRGK
1c8nA           PAWLGTIADNYSKWRWVSLRIIYSPKCPLSYDRNDVAPGRVQLSQTYKAINFPPYAGYDGAAILNTDVTP
1dtyA           DNSMHSLWKGYLPENLFAPAPQSRMDGEFARLMAAHRHEIAVIIEPIVQGAGGMRMPEWLKRIRKICDRE
1vp4A           DDESYCVLPAYLGAINAFRQYLANFVVVPDKNGKIKQVKFIYVVSNFHNPAGVTTSLEKRKALVEIAEKY
1u08A           RNGDECFDPSYDSYAPAIALSGGIVKRMALQPPHFRERTRLVILNTPHNPSATVWQQADFAALWQAIAGH
1b5oA           GDEVIVLSPYWVSYPEMVRFAGGVVVEVEERVRRAITPRTALVVNSPNNPTGAVYPKEVLEALARLAVEH
1bw0A           DAYALVPQPGFPHYETVCKAYGIGMHFYNEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEEL
2aeuA1          PKKVIHYLPELPGHPSIERSCKIVNAKYFESDKVGIDKDTLVIIT-GSTMDLKVIELENFKKVINTAKNK
1s2bA           TGFDWYGDGTYDAWYEWEVSITISEGDSIQMSVTATSDTSGSATLENLTTGQKVSKSFSNESSGSLCRTN
2gb3A1          NPGDEILVPFYANYNAFAKIAGVKLIPVPQNLESFINERKGIVLSNPCNPTGVVYGKDEXRYLVEIAERH
1b9hA           GPGTEVIVFTFISSSQAAQRLGAVTVPVPEAVAAAVTPRTKVIM--PVHMAGLMADMDALAKISADT---
1xl7A1          GGDPSVRWGDYNLISFANGIFGCCCDHAPHYVDERVLETEGRWKGSEKVRDIPLPEELVFT------VDE
1agxA           --------NSEFNIEKIQGDALPGNMMPDAYQAFAKAGVKAIIHAGTGNGSMANYLVPEVRKL---HDEQ
1lc5A           PRRAMIVTPGFAEYGRALAQSGCEIRRWSDAILEALTPDDCLFLCTPNNPTGLLPERPLLQAIADRCKSL
2igsA1          -----------------------------NIYQNPGQSKGFARQCNPGFVFPEAQAWDIPLRLHPEFIPG
1h1cA           LXFDRSVFPTYSCYRIFAKAVGAKFLEVPRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERI----LKT
1gbnA           ----------------MPGFDIIPYNDLPALERADPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRH
1fc4A           GAEDAIISDALNHASIIDCKAKRYRYANNDXLEARLKEAVLIATDGVFSXDGVIANLKGVCDLA---DKY
1cs1A           PGDLLVAPDCYGGSYRLFDSLAKRGCYREQALRAALAEKPKLVLESPSNPLLRVVDIAKICHLA---REV
2cfbA1          QREKVIKFEGCYHGHAATLTAPYNDLEAVSRLFEQYPNDIAGVILEPGNAGFIPPDAGFLEGLRELTKQY
1w9gA1          --------LLVQPTKRP---EGRTYADYMEGVCKMYEE--HLKRMNPNSPSITYDISQLFDFIDDLA--D
1aamA           ---------------------------LINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK
1vk9A           ------------------------HVEKNLLALKIFEKKDYSGRSIFESKDSGLKPVVELFKRF---DNL
2bwnA1          FPGLIIYSDSLNHASMIEGIKRNAGPKRIELIAADDPAAKLIAFESVYSMDGDFGPIKEICDI---AEEF
1v72A1          ---------------------------TREKVGDVHTTQPACVSITQATEVGSIYTLDEIEAIGDVCKSS
1fhlA           ----------------------------------------SIRQRVWVNPSDGSYDLDYNLELAKRVKAA
1mdoA           GEGDEVITPSWVSTLNXIVLLGANPVXVVTPEHIEAAITPQTKAIIPVHYAGAPADLDAIYALGERYGI-
1nc7A           ----------------------------------------FPDGYIPNGKRGYLVSHESLCIXNTGDETA
1b8gA           GEAVLIPTPYYPGFDRDLKWRTGVEIVPIQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDK
1m32A           -----------------------------QAIDAILNADPTISHIAXVHSETTTGXLNPIDEVGALAHRY
2e7iA1          DAWVVMDENCHYSSYVAAERAGLNIALVPKTDYEETKKRGEVVLALITYPDGNYGNLPDVKKIAKVCSEY
1vefA1          AHTGRKKFRGFSGRTMGSLSVTWEPKYREEALKRAVDEEAAVILEPVQGEGGVRPATPELRAAREITQEK
1d2fA           ETGEGVVIPAYDAFYKAIEGNQRTVMPVALEKQADGPECKIMLLCSPQNPTGKVWTCDELEIMADLCERH
1iugA           APGERVLVPVKFSERFYEIALEAGLVVETPRPEDVAKEGAGLLLVHSETSTGALADLPALARAFK-EKNP
1c7nA           KPGDGVITPVYYPFFMAIKNQERKIIECELLEKDGYKNNKALLFCSPHNPVGRVWKKDELQKIKDIVLKS
1wytB1          AYHEDRGEGRTRRVVLVPDSAQVREIPSGPEGKRELGPHAALMLTNPNTLGLFERRILEISRLC---KEA
1ecxA           KRTIITTPIEHKAVLETMKYLSMKGFKVKYVPVDSREDTFLVSIMAANNEVGTIQPVEDVTRI---VKKK
1cl1A           ------------------------------------------FLESPGSITMEVHDVPAIVAAVRSVVPD
2govA1          NQFQGSPPAPSDESVKIGITVYSTQFGGYAKEAHATQLRTTLE-GTPATYQGDVYYCAGYDPPMKPYGRR
1ohvA           --------------------------------KKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDISRKH
1m53A2          ---------------KLDKSLGIDAIWINPHYDSPNTDNGYDI-SNYRQIMKEYGTMEDFDSLVAEMKKR
1vjzA           ----------KEEDFLWXAQWDFNFVRIPXCHLLWSDRGNPFIIREDFFE--------KIDRVIFWGEKY
1qz9A           RVQAIVTETSNFPTDLYIAEGLADMLQQEELPQAIDQDTAVVMLTHVNYKTGYM---HDMQALTALSHEC
2fn6A1          EFSIITTPISFVATANMLLESGYTPVFAELALEKLINE-----RTKAIVSVDYAGKSVEVESVQKLCKKH
1eh9A3          -------------------DLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKK
2c0hA1          HNQYSKGKSTFESTLSDMQSHGGNSVRVWLHIEGESTPEFDNNGYVTGIDNTLI---SDMRAYLHAAQRH
1qnoA           ----------VDSTFSHISSSGLKVVRVWGFNDVNTQPSPGKLSATGSTINTGADGLQTLDYVVQSAEQH
1px8A2          --------------KYVKENIDFKYIRGHGLLCDDVGIYREDVVGDEVKPFYNF---TYIDRIFDSFLEI
1pmmA           --------PVQICWHKFARYWDVELREIPMRPIEACDENTIGVVTFGVTYTGNYEPLHDALDKFQADTGI
1ei7A           --------KPSPQVTVR---FPDSDFKVYALLGAFDTRNRIIEVENQANPTTATLDATRRVDDATVAIRS
1svvA           RPWEAVIATQLGHISTHIEATGHKKLRVADI-ESALHENRSLVYISNTTEVGTQYTKQELEDISASCKEH
1zy9A2          --------------------FPFEVFQIDDAYE-----------KDIGDWLVTRGDFPSVEEXAKVIAEN


                         +         .         .         .         .         *         .:210
query           GAYLIIDIIFSDFVTDDLRGFPLENVAYSHSTDKFYTHDLRAGWVFGDEEIVRRVKYLKDLANPGPXXXX
1fg3A           A-IVVADEAYIEFCPQASLAGWLPHLAILRTLSKAFLAGLRCGFTLANEEVINLL---------------
1c8nA           TSAIYVDVDVTRFDKAWYSTIGTAFDQNQFCPCTVHISDGGPAVAVPPGDIFFKY---------------
1dtyA           GILLIADEIATGFGRTGKLFACEEIAPDILCLGKLTGGTMTLSATLTTREVAEDGEAGCFMHGPTFMGNP
1vp4A           DLFIVEDDPYGALRYEGETVDPIERVVLLNTFSKVLAPGLRIGXVAGSKEFIRKIVQAK-----------
1u08A           EIFVISDEVYEHINFSQQGHASVERAVAVSSFGKTYHMGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPA
1b5oA           DFYLVSDEIYEHLLYEGEHFSPGRTLTVNGAAKAFAMTGWRIGYACGPKEVMASVSSQSTTSPDTIAQWA
1bw0A           RLPLFSDEIYAGMVKGKDPNATFTSVADFETTVNLVVPGWRLGWLLYVDPHGNGPSFLEGLKRGPCTVVQ
2aeuA1          EAIVFVDGARVRLLFNQPPALKLGADLVVTSTDKLM-EGPRGGLLAGKKELVDKIYI-------------
1s2bA           AEFIIEDFEECNSNGSDCEFVPFFTDCSVTSDGESVSDDAQITQVIINNQDVTDC---------------
2gb3A1          GLFLIVDEVYSEIVFRGASALSIESVVIDSVSXKFSACGARVGCLITRNEELISHAXKLAQGRLAPPLLE
1b9hA           GVPLLQDAAHAHGARWQGKRVGELDATFSFQNGKLMTAGEGGAVVFPDGETEKYETAF------------
1xl7A1          KILNDVSQAKAQHLKA------------------------------------------------------
1agxA           GLQIVRSSRVAQGFVLRNAEQPDDKYGWIAAHDLNPQKARALTKTNDAKEIQNMFW--------------
1lc5A           NINLILDEAFIDFIPHETGFIPAPHIWVLRSLTKFYAPGLRLGYLVNSDDAAMARMRRQQMPWSVNALAA
2igsA1          GDISKADQQYSTLLAQEIANGVTIGFRXVNEKERVCNVEIKARFGSGYLDRFKG----------------
1h1cA           GAFVALDEAYYEFHGESYVKKYENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRVRLPFNVSYVSQX
1gbnA           QVLFIADEIQTGLARTWLAVDYENVRPDIVLLGKALSGLYPVSAVLCDDDIMLT----------------
1fc4A           DALVXVDDSHAVGFVGENGRGSHEYDIITGTLGKALGGASGGYTAARKEVVEQRSRPYLFSNSLAPAIVA
1cs1A           GAVSVVDNTFLSPALQNPLALGADLVLHSCTXYLNGHSDVVAGVVIAKDPDVVT----------------
2cfbA1          GALLVFDEVMTGFRIAYGGAQEKFGVPDLTTLGKVIGGGLPVGAYGGRAEIMKMVAPAGPTLSGNP----
1w9gA1          LSCLVYRADTQTYQPYNKDWIKE--KIYVLLRRQA-----------------------------------
1aamA           GWLPLFDFAYQGFARGLAFAAMHKELIVASSYSKFGLYNERVGACTLVAADSETVDRAFSQMKAA-----
1vk9A           EGSLVIDKXVGKAAASFLLKXKPDHIHISKPALKLXNYGQSFSYDEKIPFVLGKDG--------------
2bwnA1          GALTYIDEVHAVGMPRGAGVAERDGLMHRIDIGTLAXAYGVFGGYIAASDAVRSYAPGFIFSTSLPPAIA
1v72A1          SLGLHMDGSRFANALVSEMTWKAGVDALSFGATKNGVL-AAEAIVLFNTSLATEMSYRRKRAGHLSSKMR
1fhlA           GMSLYLDLHLSDTWADP-----------------------------------------------------
1mdoA           --PVIEDAAHATGTSYKRHIGARGTAIFSFHAIKNITCAEGGIVVTDNPQFADKLRSL------------
1nc7A           KIRIT--FLFEDSKPVVH----------------------------------------------------
1b8gA           GIHLISDEIYSGTAFSSPSFISVMEVLKDRNCDENSEVWFRVGAIYSNDDMVVAAATKMSGLVSSQTQHL
1m32A           GKTYIVDAXSSFGGI-PXDIAALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGHSRSLSLDLLKEL
2e7iA1          DVPLLVNGAYAIGRMP-VSLKEIGADFIVGSGHKSMAASGPIGVMGMKEEWAEIV---------------
1vefA1          GALLILDEIQTGMGRTGKRFEHFGIVPDILTLAKALGGGVPLGVAVMREEVARSMPKGGHTFGGNPLAMA
1d2fA           GVRVISDEIHMDMVWGEWSNVARGDWALLTSGSKSFNPALTGAYGIIENSSSRDAYLSARDGLSSPSVLA
1iugA           EGLVGADMVTSLLVGE-VALEAMGVDAAASGSQXGLMCPPGLGFVALSPRALERLKPRGYYLDLARELKA
1c7nA           DLMLWSDEIHFDLIMPGYEHTVFDKTITFTAPSKTFNAGMGMSNIIIKNPDIRERFTKSRDAGMPFTTLG
1wytB1          GVQLYYDGANLNAIMGWARPGDMGFDVVHLNLHKTF----------------------------------
1ecxA           NKETLVHVDAVQTIGKPFSLEKLEVDYASFSAHKFHPKGVGITYIRKGVPLIHGGGQERGLRSGTQNVPG
1cl1A           -AIIMIDNTWAAGVLFKALDFGIDVSIQAATXYLVGHSDAMIGTAVCNARCWEQLRENA-----------
2govA1          NEVWLVK---------------------------------------------------------------
1ohvA           GCAFLVDEVQTGGGSTG-KFWAHEHWGLDDPADVMTFSKMMTGGFFHKEEFRPNAPYRIFNTWLGDPSKN
1m53A2          NMRLMIDVVINHTSDQHPWFIQSKSDKNNPYRDYYFWRDGKDNQPPNN----------------------
1vjzA           GIHICISLHRAPGYSVNKEVEEKTNLWKDETAQEAFIHH-------------------------------
1qz9A           GALAIWDLAHSAGAVPV-DLHQAGADYAIGCTYKYLNGPGSQAFVWVSPQLCDLVPQPL-----------
2fn6A1          SLSFLSDSSHALGEYQNKKVGGFALAVFSFHAIKPITTAEGGAVVTNDSELHEKMKLFR-----------
1eh9A3          GLGVILDVVYNHVGPEYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIK----------
2c0hA1          NILIFFT-LWNGAVKQSTHYRLNGLMVDTRKLQSYIDHALKPMA--------------------------
1qnoA           NLKLIIPFVNNWSDYGGINAYVNAFGGNAT--TWYTNTAAQTQYRKYVQAVVSRYA--------------
1px8A2          GIRPFVEIGFMPK--KLASGTQTVFYWEGNVTPPKDYEKWSDLVKAVLHHFISRYGI-------------
1pmmA           DIDMHIDAASGGFLAPFVAPDIVRVKSISASGHKFGLPLGCGWVIWRDEEALPQ----------------
1ei7A           INNLIVELIRGTGSYNR-----------------------------------------------------
1svvA           GLYLFLD---------------------------------------------------------------
1zy9A2          GFIPGIWTAPFSVSETSDVFEHPDWVVKENGEPKXAYRNWNKKIYALDLSKDEVLNWLFDLFS-------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXVKRRNLSIIKPNATALLTRFPNALYKPHMPIALIPTGCNDAKLAERLLAMGVKTVPG
1fg3A           ----------------------------------------------------------------------
1c8nA           ----------------------------------------------------------------------
1dtyA           LACAAANASLAILESGDWQQQVADIEVQLREQLAPARDAEAIGVVETTHPVNMAALQKFFVEQGVWIRPF
1vp4A           ----------------------------------------------------------------------
1u08A           QLALADMLRAEPEHYLALPDFYRQKRDILEILPCEGTYFLLVDYSAVSTLDDVEFCQWLTQEHGVAAIPL
1b5oA           TLEALTNQEASRAFVEMARDLLLEGLTALGLKAVRPSGAFYVLMDTSPIAPDEVRAAERLLEAGVAVVPG
1bw0A           AALGEALLNTPQEHLDQIVAKIEESAMYLYNHIGMYLMSRIDLEKYRDIKTDVEFFEKLLEEENVQVLPG
2aeuA1          ----------------------------------------------------------------------
1s2bA           ----------------------------------------------------------------------
2gb3A1          QIGSVGLLNLDDSFFDFVRETYRERVETVLKKLSGAFYITAELPVEDAEEFARWXLTDFNDGETTXVAPL
1b9hA           ----------------------------------------------------------------------
1xl7A1          ----------------------------------------------------------------------
1agxA           ----------------------------------------------------------------------
1lc5A           LAGEVALQDSAWQQATWH--WLREEGARFYQALCQLPLLTVYPYLLLRCEREDIDLQRRLLTQRILIRSC
2igsA1          ----------------------------------------------------------------------
1h1cA           FAKVALDHREIFEERTKFIVEERERXKSALREXGYRITDSRGNFVFVFXEKEEKELLEHLRTKNVAVRSF
1gbnA           ----------------------------------------------------------------------
1fc4A           ASIKVLEXVEAGSELRDRLWANARQFREQXSAAGFTLAGADHAIIPVGDAVVAQKFARELQKEGIYVTGF
1cs1A           ----------------------------------------------------------------------
2cfbA1          ----------------------------------------------------------------------
1w9gA1          ----------------------------------------------------------------------
1aamA           ----------------------------------------------------------------------
1vk9A           ----------------------------------------------------------------------
2bwnA1          AGAQASIAFLKTAEGQKLRDAQQMHAKMRLKALGMPIIDHGVPVVIGDPVHTKAVSDMLLSDYGVYVQPI
1v72A1          FLSAQIDAYLTDDLWLRNAR--KANAAARLAQGLEGLGGVEVTEANILFCRLDSAMIDALLKAGFGFYHD
1fhlA           ----------------------------------------------------------------------
1mdoA           ----------------------------------------------------------------------
1nc7A           ----------------------------------------------------------------------
1b8gA           LSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNARSNTFEAEMELWKKIVYVHLNISPG
1m32A           AKEGGVAARHQRYQQNQRSLVAGXRALGFNTLLDDELHSPIITAFYSPEDPQFSEFYRRLKEQGFVIYPG
2e7iA1          ----------------------------------------------------------------------
1vefA1          AGVAAIRYLERTRLWERAAELGPWFMEKLRAIPSPKIREVGLMVGLELKEKAAPYIARLEKEHRVLALQA
1d2fA           LTAHIAAYQQGAPWLDALRIYLKDNLADKMNAAFPELNWQLAWLDLRPLNIDDNALQKALIEQEVAIMPG
1iugA           QKEGESAWTPAINLVLAVAAVLEEWQNALLYGVGEEGGLRPVPAFYLPEGVPYARVKEAFAQRGAVIAGG
1c7nA           YKACEICYKECGKWLDGCIKVIDKNQRIVKDFFEVNHPEILQWIDFRALKMDHKAMEEFMIHAQIFFDEG
1wytB1          ----------------------------------------------------------------------
1ecxA           IVGAARAMEIAVEELSEAAKHMEKLRSKLVSGLMNLGAHIITPLSVSFPNIRGSTLQNLLSGYGIYVSTH
1cl1A           ----------------------------------------------------------------------
2govA1          ----------------------------------------------------------------------
1ohvA           LLLAEVINIIKREDLLSNAAHAGKVLLTGLLDLQARYPQFISRVRDTPDESIRNKLISIARNKGVMLGGC
1m53A2          ----------------------------------------------------------------------
1vjzA           ----------------------------------------------------------------------
1qz9A           ----------------------------------------------------------------------
2fn6A1          ----------------------------------------------------------------------
1eh9A3          ----------------------------------------------------------------------
2c0hA1          ----------------------------------------------------------------------
1qnoA           ----------------------------------------------------------------------
1px8A2          ----------------------------------------------------------------------
1pmmA           ----------------------------------------------------------------------
1ei7A           ----------------------------------------------------------------------
1svvA           ----------------------------------------------------------------------
1zy9A2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RLFQAPYSIRVGLGVEEPPRFREALEILAQGWxxx
1fg3A           -----------------------------------
1c8nA           -----------------------------------
1dtyA           -----GKLIYLMPPIILPQQLQRLTAAVNR-----
1vp4A           -----------------------------------
1u08A           SVFCADPFIRLCFAKKE-STLLAAAERLRQ-----
1b5oA           TDFAAFGHVRLSYATSE-ENLRKALERFAR-----
1bw0A           TIFHAPGFTRLTTTRPV-EVYREAVERIKA-----
2aeuA1          -----------------------------------
1s2bA           -----------------------------------
2gb3A1          RGFYLTPGIRIACVLEK-DLLSRAIDVLXE-----
1b9hA           -----------------------------------
1xl7A1          -----------------------------------
1agxA           -----------------------------------
1lc5A           ANYLDSRYYRVAIRSAA--QNERLLAALRN-----
2igsA1          -----------------------------------
1h1cA           REG-----VRITIGKRE--ENDXILRELEV-----
1gbnA           -----------------------------------
1fc4A           FYPKGQARIRTQXSAAHTPQITRAVEAFTR-----
1cs1A           -----------------------------------
2cfbA1          -----------------------------------
1w9gA1          -----------------------------------
1aamA           -----------------------------------
1vk9A           -----------------------------------
2bwnA1          NFPRGTERLRFTPSPVHDLQIDGLVHAMDLLW---
1v72A1          RWGPNVVRFVTSFATTA-EDVDHLLNQVRL-----
1fhlA           -----------------------------------
1mdoA           -----------------------------------
1nc7A           -----------------------------------
1b8gA           SSCTEPGWFRVCFANLPERTLDLAMQRLKA-----
1m32A           KVSQSDC-FRIGNIGADITALLTAIR-TAXYW---
2e7iA1          -----------------------------------
1vefA1          ----GPTVIRFLPPLEDLERVVEAV----------
1d2fA           YTYEGRGFVRLNAGCPR-SKLEKGVAGLIN-----
1iugA           QGPLKGKVFRLSLMAYDRYEALGVAGMFRE-----
1c7nA           YIFGGIGFERINLAAPS-SVIQESLERLNK-----
1wytB1          -----------------------------------
1ecxA           VLDIAQGAIRISLCKYNTEEVDYFLKKIEE-----
1cl1A           -----------------------------------
2govA1          -----------------------------------
1ohvA           ----GDKSIRFRPTVFRDHHAHLFLNIFSD-----
1m53A2          -----------------------------------
1vjzA           -----------------------------------
1qz9A           -----------------------------------
2fn6A1          -----------------------------------
1eh9A3          -----------------------------------
2c0hA1          -----------------------------------
1qnoA           -----------------------------------
1px8A2          -----------------------------------
1pmmA           -----------------------------------
1ei7A           -----------------------------------
1svvA           -----------------------------------
1zy9A2          -----------------------------------