[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for paer1:AAL65085.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1r30A.bssp"
#ERROR : Can't open dsspfile "1tv7A.bssp"
#ERROR : Can't open dsspfile "2h7aA1.bssp"
#ERROR : Can't open dsspfile "1iwmA.bssp"
#ERROR : Can't open dsspfile "1n7kA.bssp"
#ERROR : Can't open dsspfile "2q02A1.bssp"
#ERROR : Can't open dsspfile "2g0wA1.bssp"
#ERROR : Can't open dsspfile "1rhcA.bssp"
#ERROR : Can't open dsspfile "1b73A2.bssp"
#ERROR : Can't open dsspfile "2p10A1.bssp"

## Summary of PDB Search
:364
    8e-25  25%  1r30A  [c.1.28.1] BIOTIN SYNTHASE
    3e-19  20%  1tv7A  [c.1.28.3] MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN A
    1e-11  10%  2h7aA1 [d.350.1.1] HYPOTHETICAL PROTEIN YCGL A:2 -- 110
    2e-07   8%  1iwmA  [b.125.1.2] OUTER MEMBRANE LIPOPROTEIN LOLB
    1e-05  22%  1n7kA  [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    2e-05  25%  2q02A1 [c.1.15.4] PUTATIVE CYTOPLASMIC PROTEIN A:1 -- 271
    3e-05  16%  2g0wA1 [c.1.15.4] LMO2234 PROTEIN A:10 -- 284
    2e-04  14%  1rhcA  [c.1.16.3] F420-DEPENDENT ALCOHOL DEHYDROGENASE
    7e-04  23%  1b73A2 [c.78.2.1] GLUTAMATE RACEMASE A:106 -- 252
    8e-04  21%  2p10A1 [c.1.12.9] MLL9387 PROTEIN A:8 -- 204
:364

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r30A           ----------------------------------------------------------------------
1tv7A           ----------------------------------------------------------------------
2h7aA1          ----------------------------------------------------------------------
1iwmA           ----------------------------------------------------------------------
1n7kA           ----------------------------------------------------------------------
2q02A1          ----------------------------------------------------------------------
2g0wA1          ----------------------------------------------------------------------
1rhcA           ----------------------------------------------------------------------
1b73A2          ----------------------------------------------------------------------
2p10A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxHFYPGTSAVTISTWGCNFPCAWCQNWHLSKTASPAGAYVPPERVVEWALE
1r30A           --------------------HFDPRSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK
1tv7A           --------------------------------TDRCNFRCDYCMPKEVFGDDFPKNELLTFDRIAKVYAE
2h7aA1          --------------------------------LKSKSMFCVIYRSSKRDQTYLYVEKKDDFSRVPEELMK
1iwmA           ----------------------------------------------------------------------
1n7kA           -----------------------------------------------------PLGQAPLEVKLVETVLE
2q02A1          ----------------------------------------------------------------------
2g0wA1          ----------------------------------------------------------------------
1rhcA           -------------------------------------------------------------PKGAKLAGM
1b73A2          ----------------------------------------------------------------------
2p10A1          --------------------------------------------------------------------LA


                         +         .         .         .         .         *         .:210
query           NGDSGVNVSFNEPTLLAEYAEEVFRLARARGLHASINTNGYLTEEAVRRLAEAGMEGMNIDIKGGRETYR
1r30A           AKAAGSTAAWKNPHEDMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG
1tv7A           LGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLF
2h7aA1          GFGQPQLAMIGRKKLVNADIEKVKQALTEQGYYLQLPPPPEDLLKQHLSVMGQKTDDTN-----------
1iwmA           --------QWRQHQQDVRTRGAFAYISDQQKVYARFFWQTGQDRYRLLLTNPLGSTELELNAQPGNVQLV
1n7kA           AGDVVPHLSLGPEAVYREVSGIV-KLAKSYGAVKVILEAPLWDDKTLSLLVDSSRRA-GADVKTS--TGV
2q02A1          --------------------EAFFRLVKRLEFNKSGSVTDDLNYNQVRNLAEKY--GLEIVTINAVYPFN
2g0wA1          --------TISSYTLGTEVSPKRVKVAAENGFDGDALAAGLTDEDXLRILDEHNXKVTEVEYITQWGTAE
1rhcA           YGDHLMTVAAAPSTLKNVTIPKFEEGAREAGKDMLIWYSVDPDYDKAVEALRFWAGCLVPSMFK------
1b73A2          --------------KLEEGGADV--FAKACPLFAPLAEEGLLEGEITRKVVEHYLKKGKIDTLILGCTHY
2p10A1          YGNANQIV--------VDXAREVLPVVRHTPVLAGVNGTDPFXSTFLRELKEIGFAGVQNFPTVGLDGLF


                         .         .         .         +         .         .         .:280
query           RWLAANFDKFLSTARHAKGMGIHVEFTYLVIPGVNDHEAEEVIEAVASFGRETPLHITAYYPAHxxxxxx
1r30A           NIITRTYQERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTP------------------
1tv7A           QSINNRATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLE--------------------------
2h7aA1          ----------------------------------------------------------------------
1iwmA           DNKGYTADDAEEMIGKLTGMPIPLNSLRQWIPGDATDYKLDDQYRLSEITYSQNGKNWKVVY--------
1n7kA           YTKGGDPVTVFRLASLAKPLGMGVK----ASGGIRSGIAVLAVGAGAD----------------------
2q02A1          QLTEEVVKKTEGLLRDAQGVGA----RALVLCPLNDEVTVEAIKRLSDLFAR------------------
2g0wA1          DRTAEQQKKEQTTFHXARLFGV----KHINCGLLEKIPEEQIIVALGELCDRAEELIIGLEFXP------
1rhcA           ----------------------------------------------------------------------
1b73A2          PLLKKEIKKFLGDAEVVDSSEALSLSLFIKDDGSSSLELSPNLQFLIILGRDYPVK--------------
2p10A1          RQNLEETAQEVEXIAEAHKLDL------LTTPYVSPEDAVAXAKAGADI---------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r30A           ----------------------------------------------------------------------
1tv7A           ----------------------------------------------------------------------
2h7aA1          ----------------------------------------------------------------------
1iwmA           ----------------------------------------------------------------------
1n7kA           ----------------------------------------------------------------------
2q02A1          ----------------------------------------------------------------------
2g0wA1          ----------------------------------------------------------------------
1rhcA           ----------------------------------------------------------------------
1b73A2          ----------------------------------------------------------------------
2p10A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxx
1r30A           --------------
1tv7A           --------------
2h7aA1          --------------
1iwmA           --------------
1n7kA           --------------
2q02A1          --------------
2g0wA1          --------------
1rhcA           --------------
1b73A2          --------------
2p10A1          --------------