[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:uvrC

[Show Plain Result]

#ERROR : Can't open dsspfile "2nrvA.bssp"
#ERROR : Can't open dsspfile "2nrtA.bssp"
#ERROR : Can't open dsspfile "2nrvB.bssp"
#ERROR : Can't open dsspfile "2nrzB.bssp"
#ERROR : Can't open dsspfile "2nrxB.bssp"
#ERROR : Can't open dsspfile "2nrwA.bssp"
#ERROR : Can't open dsspfile "3c65A.bssp"
#ERROR : Can't open dsspfile "1yd6D.bssp"
#ERROR : Can't open dsspfile "2nrrA.bssp"
#ERROR : Can't open dsspfile "1yd6A.bssp"
#ERROR : Can't open dsspfile "1yd6B.bssp"
#ERROR : Can't open dsspfile "1yd6C.bssp"
#ERROR : Can't open dsspfile "1yczA.bssp"
#ERROR : Can't open dsspfile "1yd4A.bssp"
#ERROR : Can't open dsspfile "1yd3A.bssp"
#ERROR : Can't open dsspfile "1yd2A.bssp"
#ERROR : Can't open dsspfile "1yd5A.bssp"
#ERROR : Can't open dsspfile "1kftA.bssp"
#ERROR : Can't open dsspfile "1x2iA.bssp"

## Summary of PDB Search
:611
    3e-32  37%  2nrvA  [x.x.x] UVRABC SYSTEM PROTEIN C
    3e-32  37%  2nrtA  [x.x.x] UVRABC SYSTEM PROTEIN C
    7e-31  38%  2nrvB  [x.x.x] UVRABC SYSTEM PROTEIN C
    1e-29  37%  2nrzB  [x.x.x] UVRABC SYSTEM PROTEIN C
    2e-29  38%  2nrxB  [x.x.x] UVRABC SYSTEM PROTEIN C
    6e-28  39%  2nrwA  [x.x.x] UVRABC SYSTEM PROTEIN C
    3e-16  37%  3c65A  [x.x.x] UVRABC SYSTEM PROTEIN C
    2e-13  35%  1yd6D  [x.x.x] UVRC
    1e-12  35%  2nrrA  [x.x.x] UVRABC SYSTEM PROTEIN C
    3e-12  34%  1yd6A  [x.x.x] UVRC
    1e-11  35%  1yd6B  [x.x.x] UVRC
    2e-11  33%  1yd6C  [x.x.x] UVRC
    3e-10  36%  1yczA  [x.x.x] UVRABC SYSTEM PROTEIN C
    9e-10  35%  1yd4A  [x.x.x] UVRABC SYSTEM PROTEIN C
    9e-10  35%  1yd3A  [x.x.x] UVRABC SYSTEM PROTEIN C
    9e-10  35%  1yd2A  [x.x.x] UVRABC SYSTEM PROTEIN C
    3e-09  35%  1yd5A  [x.x.x] UVRABC SYSTEM PROTEIN C
    6e-06  36%  1kftA  [a.60.2] EXCINUCLEASE ABC SUBUNIT C
    1e-05  40%  1x2iA  [x.x.x] HEF HELICASE/NUCLEASE
:611

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxKDVIRKELPLIPKSPGVYRMLDHKDVILYVGKAKNLPNRLKSYVAEKNHIIRTARMLSQTFKL
2nrvA           ----------------------------------------------------------------------
2nrtA           ----------------------------------------------------------------------
2nrvB           ----------------------------------------------------------------------
2nrzB           ----------------------------------------------------------------------
2nrxB           ----------------------------------------------------------------------
2nrwA           ----------------------------------------------------------------------
3c65A           ----------------------------------------------------------------------
1yd6D           ----------LKEKLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKERVRSYFT-GTHDGKTQRLVEEIADF
2nrrA           ----------------------------------------------------------------------
1yd6A           ----------LKEKLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKERVRSYFT-GTHDGKTQRLVEEIADF
1yd6B           -------------KLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKERVRSYFT-GTHDGKTQRLVEEIADF
1yd6C           ----------LKEKLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKERVRSYFT-GTHDGKTQRLVEEIADF
1yczA           -------KEKIRKKILLAPEEPGVY-IFKNKGVPIYIGKAKRLSNRLRSYLNPQTE--KVFRIGEEADEL
1yd4A           -------KEKIRKKILLAPEEPGVY-IFKNKGVPIFIGKAKRLSNRLRSYLNPQTE--KVFRIGEEADEL
1yd3A           -------KEKIRKKILLAPEEPGVY-IFKNKGVPIYIGKAKRLSNRLRSFLNPQTE--KVFRIGEEADEL
1yd2A           -------KEKIRKKILLAPEEPGVF-IFKNKGVPIYIGKAKRLSNRLRSYLNPQTE--KVFRIGEEADEL
1yd5A           -------KEKIRKKILLAPEEPGVY-IFKNKGVPIYIGKAKRLSNRLRSYLNPQTE--KVFRIGEEADEL
1kftA           ----------------------------------------------------------------------
1x2iA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EIXXXXXXXXXXXXXXXXIKKHKPKFNILLKDDKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2nrvA           ----------------------------------------------------------------------
2nrtA           ----------------------------------------------------------------------
2nrvB           ----------------------------------------------------------------------
2nrzB           ----------------------------------------------------------------------
2nrxB           ----------------------------------------------------------------------
2nrwA           ----------------------------------------------------------------------
3c65A           ----------------------------------------------------------------------
1yd6D           EYIVTSSNAEALILEMNLIKKHDPKYNVMLKDDK------------------------------------
2nrrA           ----------------------------------------------------------------------
1yd6A           EYIVTSSNAEALILEMNLIKKHDPKYNVMLKD--------------------------------------
1yd6B           EYIVTSSNAEALILEMNLIKKHDPKYNVMLKD--------------------------------------
1yd6C           EYIVTSSNAEALILEMNLIKKHDPKYNVMLK---------------------------------------
1yczA           ETIVVMNEREAFILEANLIKKYRPKYNV------------------------------------------
1yd4A           ETIVVMNEREAFILEANLIKKYRPKYNV------------------------------------------
1yd3A           ETIVVMNEREAFILEANLIKKYRPKYNV------------------------------------------
1yd2A           ETIVVMNEREAFILEANLIKKYRPKYNV------------------------------------------
1yd5A           ETIVVMNEREAFILEANLIKKYRPKYAV------------------------------------------
1kftA           ----------------------------------------------------------------------
1x2iA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2nrvA           ----------------------------------------------------------------------
2nrtA           ----------------------------------------------------------------------
2nrvB           ----------------------------------------------------------------------
2nrzB           ----------------------------------------------------------------------
2nrxB           ----------------------------------------------------------------------
2nrwA           ----------------------------------------------------------------------
3c65A           ----------------------------------------------------------------------
1yd6D           ----------------------------------------------------------------------
2nrrA           ----------------------------------------------------------------------
1yd6A           ----------------------------------------------------------------------
1yd6B           ----------------------------------------------------------------------
1yd6C           ----------------------------------------------------------------------
1yczA           ----------------------------------------------------------------------
1yd4A           ----------------------------------------------------------------------
1yd3A           ----------------------------------------------------------------------
1yd2A           ----------------------------------------------------------------------
1yd5A           ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1x2iA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2nrvA           ----------------------------------------------------------------------
2nrtA           ----------------------------------------------------------------------
2nrvB           ----------------------------------------------------------------------
2nrzB           ----------------------------------------------------------------------
2nrxB           ----------------------------------------------------------------------
2nrwA           ----------------------------------------------------------------------
3c65A           ----------------------------------------------------------------------
1yd6D           ----------------------------------------------------------------------
2nrrA           ----------------------------------------------------------------------
1yd6A           ----------------------------------------------------------------------
1yd6B           ----------------------------------------------------------------------
1yd6C           ----------------------------------------------------------------------
1yczA           ----------------------------------------------------------------------
1yd4A           ----------------------------------------------------------------------
1yd3A           ----------------------------------------------------------------------
1yd2A           ----------------------------------------------------------------------
1yd5A           ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1x2iA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2nrvA           ----------------------------------------------------------------------
2nrtA           ----------------------------------------------------------------------
2nrvB           ----------------------------------------------------------------------
2nrzB           ----------------------------------------------------------------------
2nrxB           ----------------------------------------------------------------------
2nrwA           ----------------------------------------------------------------------
3c65A           ----------------------------------------------------------------------
1yd6D           ----------------------------------------------------------------------
2nrrA           ----------------------------------------------------------------------
1yd6A           ----------------------------------------------------------------------
1yd6B           ----------------------------------------------------------------------
1yd6C           ----------------------------------------------------------------------
1yczA           ----------------------------------------------------------------------
1yd4A           ----------------------------------------------------------------------
1yd3A           ----------------------------------------------------------------------
1yd2A           ----------------------------------------------------------------------
1yd5A           ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1x2iA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxKNLFEGVAKKFDLKNGLNLVEVYDNSHISGTNSVGAMITFGNE
2nrvA           ---------------------------KEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVF-ED
2nrtA           ---------------------------KEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVF-ED
2nrvB           ---------------------------KEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVF-ED
2nrzB           ---------------------------KEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVF-ED
2nrxB           ---------------------------KEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVF-ED
2nrwA           ---------------------------KEALEELMKLLNMKDFPYRIEGIDISH-----TVASLVVF-ED
3c65A           ----------------------------------------------IEAFDNSNIYGADPVSALVVFLDG
1yd6D           ----------------------------------------------------------------------
2nrrA           -------------------------------EELMKLLNMKDFPYRIEGIDISHLY---TVASLVVF-ED
1yd6A           ----------------------------------------------------------------------
1yd6B           ----------------------------------------------------------------------
1yd6C           ----------------------------------------------------------------------
1yczA           ----------------------------------------------------------------------
1yd4A           ----------------------------------------------------------------------
1yd3A           ----------------------------------------------------------------------
1yd2A           ----------------------------------------------------------------------
1yd5A           ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1x2iA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GFVKKRYRKFDIKTKGNEQDDFAMLKEVLTRRFKRAMLEKGNYLTLPDLILIDGGKGQYSSAKEVLDEFG
2nrvA           GFPKKGYRRYKIEQ--DHPDDYESIRTVVKRRYSKH--------PLPNLLFVDGGIGQVNAAIEALKEIG
2nrtA           GFPKKGYRRYKIEQ--DHPDDYESIRTVVKRRYSKH--------PLPNLLFVDGGIGQVNAAIEALKEIG
2nrvB           GFPKKGYRRYKIEQ--DHPDDYESIRTVVKRRYSKH--------PLPNLLFVDGGIGQVNAAIEALKEIG
2nrzB           GFPKKGYRRYKIEQ--DHPDDYESIRTVVKRRYSKH--------PLPNLLFVDGGIGQVNAAIEALKEIG
2nrxB           GFPKKGYRRYKIEQ--DHPDDYESIRTVVKRRYSKH--------PLPNLLFVDGGIGQVNAAIEALKEIG
2nrwA           GFPKKGYRRYKI-----EQDDYESIRTVVKRRYSKH--------PLPNLLFVDGGIGQVNAAIEALKEIG
3c65A           KPAKKEYRKYKVKTVAGPND---XXXXXXXXXXXXXXLKEG--LPLPDLIIIDGGKGHLSAVRDVLEELG
1yd6D           ----------------------------------------------------------------------
2nrrA           GFPKKGYRRYKI-------DDYESIRTVVKRRYSKH--------PLPNLLFVDGGIGQVNAAIEALKEIG
1yd6A           ----------------------------------------------------------------------
1yd6B           ----------------------------------------------------------------------
1yd6C           ----------------------------------------------------------------------
1yczA           ----------------------------------------------------------------------
1yd4A           ----------------------------------------------------------------------
1yd3A           ----------------------------------------------------------------------
1yd2A           ----------------------------------------------------------------------
1yd5A           ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1x2iA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           LHDLPMIAIAKGKLRNSGDETFFYKGKSFKFDKNDPTLFFMQRLRDEAHRFAITSHRAKRAKGITKSLLD
2nrvA           -KDCPVVGLAKK------EETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLD
2nrtA           -KDCPVVGLAKK------EETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLD
2nrvB           -KDCPVVGLAKK------EETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLD
2nrzB           -KDCPVVGLAKK------EETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRES-----LRSVLD
2nrxB           -KDCPVVGLA--------EETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRSLR------SVLD
2nrwA           -KDCPVVGLAKK------EETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRES-----LRSVLD
3c65A           L-DVPLAGLSELLAGDPPDVV--------PLDRQSQEFYLLQRIQDEVHRFAV-----------------
1yd6D           ----------------------------------------------------------------------
2nrrA           -KDCPVVGLA----------TVVFENREIHLPHDHPVLRLLVQIRDETHRFAVS----------------
1yd6A           ----------------------------------------------------------------------
1yd6B           ----------------------------------------------------------------------
1yd6C           ----------------------------------------------------------------------
1yczA           ----------------------------------------------------------------------
1yd4A           ----------------------------------------------------------------------
1yd3A           ----------------------------------------------------------------------
1yd2A           ----------------------------------------------------------------------
1yd5A           ----------------------------------------------------------------------
1kftA           ------------------------------------------------------------------SSLE
1x2iA           -------------------------------------------------------------------IVE


                         .         .         .         *         .         .         .:630
query           QIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKIYxxxxx
2nrvA           NVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTE-IARRV------
2nrtA           NVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTE-IARRV------
2nrvB           -VPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTE-IARRV------
2nrzB           NVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTE-IARRV------
2nrxB           NVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTE-IARRV------
2nrwA           NVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTE-IARRV------
3c65A           ---------------------------------------------------
1yd6D           ---------------------------------------------------
2nrrA           ---------------------------------------------------
1yd6A           ---------------------------------------------------
1yd6B           ---------------------------------------------------
1yd6C           ---------------------------------------------------
1yczA           ---------------------------------------------------
1yd4A           ---------------------------------------------------
1yd3A           ---------------------------------------------------
1yd2A           ---------------------------------------------------
1yd5A           ---------------------------------------------------
1kftA           TIEGVGPKRRQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF-----
1x2iA           GLPHVSATLARRLLKHFGSVERVFTASVAELMKVEGIGEKIAKEI------