[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:ilvE

[Show Plain Result]

#ERROR : Can't open dsspfile "1iyeA.bssp"
#ERROR : Can't open dsspfile "1a3gA.bssp"
#ERROR : Can't open dsspfile "1i1kA.bssp"
#ERROR : Can't open dsspfile "1wrvB.bssp"
#ERROR : Can't open dsspfile "2eiyB.bssp"
#ERROR : Can't open dsspfile "2ej0D.bssp"
#ERROR : Can't open dsspfile "1wrvC.bssp"
#ERROR : Can't open dsspfile "2ej0E.bssp"
#ERROR : Can't open dsspfile "2eiyC.bssp"
#ERROR : Can't open dsspfile "1wrvA.bssp"
#ERROR : Can't open dsspfile "2ej0F.bssp"
#ERROR : Can't open dsspfile "2ej2E.bssp"
#ERROR : Can't open dsspfile "1daaA.bssp"
#ERROR : Can't open dsspfile "5daaA.bssp"
#ERROR : Can't open dsspfile "1a0gB.bssp"
#ERROR : Can't open dsspfile "1a0gA.bssp"
#ERROR : Can't open dsspfile "1g2wA.bssp"
#ERROR : Can't open dsspfile "3dtgA.bssp"
#ERROR : Can't open dsspfile "3cswC.bssp"
#ERROR : Can't open dsspfile "3cswA.bssp"
#ERROR : Can't open dsspfile "1i2kA.bssp"
#ERROR : Can't open dsspfile "2hhfB.bssp"
#ERROR : Can't open dsspfile "2hdkA.bssp"
#ERROR : Can't open dsspfile "2hg8B.bssp"
#ERROR : Can't open dsspfile "1kt8A.bssp"
#ERROR : Can't open dsspfile "1et0A.bssp"
#ERROR : Can't open dsspfile "1ekfA.bssp"
#ERROR : Can't open dsspfile "2a1hA.bssp"

## Summary of PDB Search
:293
    5e-48  40%  1iyeA  [e.17.1] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    9e-45  41%  1a3gA  [e.17.1] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    1e-44  40%  1i1kA  [e.17.1] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    4e-43  37%  1wrvB  [x.x.x] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    4e-43  37%  2eiyB  [x.x.x] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    4e-42  38%  2ej0D  [x.x.x] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    7e-40  38%  1wrvC  [x.x.x] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    7e-40  38%  2ej0E  [x.x.x] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    7e-40  38%  2eiyC  [x.x.x] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    1e-39  37%  1wrvA  [x.x.x] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    6e-36  35%  2ej0F  [x.x.x] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    1e-35  35%  2ej2E  [x.x.x] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    3e-18  26%  1daaA  [e.17.1] D-AMINO ACID AMINOTRANSFERASE
    4e-18  25%  5daaA  [e.17.1] D-AMINO ACID AMINOTRANSFERASE
    1e-17  26%  1a0gB  [e.17.1] D-AMINO ACID AMINOTRANSFERASE
    1e-17  26%  1a0gA  [e.17.1] D-AMINO ACID AMINOTRANSFERASE
    1e-16  25%  1g2wA  [e.17.1] D-ALANINE AMINOTRANSFERASE
    7e-13  28%  3dtgA  [x.x.x] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    6e-12  40%  3cswC  [x.x.x] PUTATIVE BRANCHED-CHAIN-AMINO-ACID
    6e-12  40%  3cswA  [x.x.x] PUTATIVE BRANCHED-CHAIN-AMINO-ACID
    5e-07  25%  1i2kA  [e.17.1] 4-AMINO-4-DEOXYCHORISMATE LYASE
    3e-05  24%  2hhfB  [x.x.x] BRANCHED-CHAIN-AMINO-ACID AMINOTRANSFERASE,
    3e-05  25%  2hdkA  [x.x.x] BRANCHED-CHAIN-AMINO-ACID AMINOTRANSFERASE,
    4e-05  25%  2hg8B  [x.x.x] BRANCHED-CHAIN-AMINO-ACID AMINOTRANSFERASE,
    7e-05  24%  1kt8A  [e.17.1] BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE,
    7e-05  25%  1et0A  [e.17.1] 4-AMINO-4-DEOXYCHORISMATE LYASE
    1e-04  24%  1ekfA  [e.17.1] BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE
    1e-04  24%  2a1hA  [x.x.x] BRANCHED CHAIN AMINOTRANSFERASE
:293

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIPYDKRSGKIWFNGELVDWADAKIHVLNHGLHYASCVFEGERVYDNSIFKLEEHTSRLFYSAKRMGIKI
1iyeA           ----------IWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHVFRHREHMQRLHDSAKIYRFPV
1a3gA           ----------IWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHVFRHREHMQRLHDSAKIYRFPV
1i1kA           ----------IWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHVFRHREHMQRLHDSAKIYRFPV
1wrvB           ------KAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAIFRLKEHVKRFYNSAKVLRMEI
2eiyB           ------KAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAIFRLKEHVKRFYNSAKVLRMEI
2ej0D           ------KAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAIFRLKEHVKRFYNSAKVLRMEI
1wrvC           ------KAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAIFRLKEHVKRFYNSAKVLRMEI
2ej0E           ------KAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAIFRLKEHVKRFYNSAKVLRMEI
2eiyC           ------KAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAIFRLKEHVKRFYNSAKVLRMEI
1wrvA           ------KAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAIFRLKEHVKRFYNSAKVLRMEI
2ej0F           ------KAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAIFRLKEHVKRFYNSAKVLRMEI
2ej2E           ------KAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAIFRLKEHVKRFYNSAKVLRMEI
1daaA           --------GYTLWNDQIVKDEEVKIDKEDRGYQFGDGVYEVVKVYNGEMFTVNEHIDRLYASAEKIRITI
5daaA           --------GYTLWNDQIVKDEEVKIDKEDRGYQFGDGVYEVVKVYNGEMFTVNEHIDRLYASAEKIRITI
1a0gB           --------GYTLWNDQIVKDEEVKIDKEDRGYQFGDGVYEVVKVYNGEMFTVNEHIDRLYASAEKIRITI
1a0gA           --------GYTLWNDQIVKDEEVKIDKEDRGYQFGDGVYEVVKVYNGEMFTVNEHIDRLYASAEKIRITI
1g2wA           --------GYTLWNDQIVKDEEVKIDKEDRGYQFGDGVYEVVKVYNGEMFTVNEHIDRLYASAEKIRITI
3dtgA           MVSIDYTVDEGWHNAQVIPYGPIQLDPSAIVLHYGQEIFEGLKAYDGSIVSFRPEXXXXXXXXXXXXXXI
3cswC           ----------------------------------------------------------------------
3cswA           ----------------------------------------------------------------------
1i2kA           --------------------------VSDRATQFGDGCFTTARVIDGKVSLLSAHIQRLQDACQRLMISC
2hhfB           ---------KGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKLFRPWLNMDRMLRSAMRLLPSF
2hdkA           ---------KGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKLFRPWLNMDRMLRSAMRLCLSF
2hg8B           ---------KGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKLFRPWLNMDRMLRSAMRLCLSF
1kt8A           ---------KGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKLFRPWLNMDRMLRSAMRLCLSF
1et0A           --------------------------VSDRATQFGDGCFTTARVIDGKVSLLSAHIQRLQDACQRLMISC
1ekfA           ---------KGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKLFRPWLNMDRMLRSAMRLCLSF
2a1hA           ---------KGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKLFRPWLNMDRMLRSAMRLCLSF


                         .         .         *         .         .         .         .:140
query           PYTEEEINLASKKIISVQGVKDGYVRPTIWRGSEMMAISAQQTKIHVAIATWEWGSYFDPKLKIEGIKLN
1iyeA           SQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGSTDVIIAAFPWGAYLGAEALEQGIDAM
1a3gA           SQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAYSTDVIIAAFPW----------QGIDAM
1i1kA           SQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAYSTDVIIAAFPWALE-------QGIDAM
1wrvB           PFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNLPNNPAEVMVAAWEWGAYLGEEAVRKGARLI
2eiyB           PFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNLPNNPAEVMVAAWEWGAYLGEEAVRKGARLI
2ej0D           PFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNLPNNPAEVMVAAWEWGAY----LVRKGARLI
1wrvC           PFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNLPNNPAEVMVAAWEW----------KGARLI
2ej0E           PFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNLPNNPAEVMVAAWEWGA-----------RLI
2eiyC           PFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNLPNNPAEVMVAAWEW----------KGARLI
1wrvA           PFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNLPNNPAEVMVAAWEWVR--------KGARLI
2ej0F           PFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPNNPXXXXXXXXXXXXXXRK----GARLI
2ej2E           PFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPNN------PXXXXXXXXXXXXRKGARLI
1daaA           PYTKDKFHQLLHELVEKNELNTGHIYFQVTRGTSPRAHQFPENTVKPVII----GYTKENPRPLENLEKG
5daaA           PYTKDKFHQLLHELVEKNELNTGHIYFQVTRGTSPRAHQFPENTVKPVII----GYTKENPRPLENLEKG
1a0gB           PYTKDKFHQLLHELVEKNELNTGHIYFQVTRGTSPRAHQFPENTVKPVII----GYTKENPRPLENLEKG
1a0gA           PYTKDKFHQLLHELVEKNELNTGHIYFQVTRGTSPRAHQFPENTVKPVII----GYTKENPRPLENLEKG
1g2wA           PYTKDKFHQLLHELVEKNELNTGHIYFQVTRGTSPRAHQFPENTVKPVII----GYTKENPRPLENLEKG
3dtgA           PELPEEVFIESRQLIAVDGEESLYLRPFVIATEPGLGVRPSNEYRYLLIAS-PAGAYFKGGIKPVSVWLS
3cswC           -----------------------------------------------------------------GVEVK
3cswA           -----------------------------------------------------------------GVEVK
1i2kA           PQLEQEMKLAAEQ-------QNGVLKVVISRGSGGRGYSTLNSGPATRISVTAYPAHYD-RLRNEGITLA
2hhfB           DKXXXXXXXXXXXXVDKDWVPDAYVRPVLIGNEPSLGVS-QPRRALLFVILCPVGAYF-PGGSVTPVSLF
2hdkA           DKXXXXXXXXXXXXVDKDWVPDAYVRPVLIGNEPSLGVS-QPRRALLFVILCPVGAYF-PGGSVTPVSLF
2hg8B           DKXXXXXXXXXXXXVDKDWVPDAYVRPVLIGNEPSLGVS-QPRRALLFVILCPVGAYF-PGGSVTPVSLF
1kt8A           DKXXXXXXXXXXXXVDKDWVPDAYVRPVLIGNEPSLGVS-QPRRALLFVILCPVGAYVTP-VSLLADPAF
1et0A           PQLEQEMKLAAEQ-------QNGVLKVVISRGSGGRGYSTLNSGPATRI------------LSVTAITLA
1ekfA           DKXXXXXXXXXXXXVDKDWVPDAYVRPVLIGNEPSLGVS-QPRRALLFVILCPVGAYF-PGGSVTPVSLF
2a1hA           DKXXXXXXXXXXXXVDKDWVPDAYVRPVLIGNEPSLGVS-QPRRALLFVILCPVGAYF-PGGSVTPVSLF


                         +         .         .         .         .         *         .:210
query           ISNWRRPAPNTIPWDTKASGLYMICTLSKHEAEQQGYTDSLMLDHEGNVAEATGANIFFKDKNGEIHTPI
1iyeA           VSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENL-FEVKDGVLFTPF
1a3gA           VSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENL-FEVKDGVLFTPF
1i1kA           VSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENL-FEVKDGVLFTPF
1wrvB           TSSWARFPANVMPGKAKVGGNYVNSALAKMXXXXXXXXXXXXXXXXXYVAEGSGENLFFV-RDGVIYALE
2eiyB           TSSWARFPANVMPGKAKVGGNYVNSALAKMXXXXXXXXXXXXXXXXXYVAEGSGENLFFV-RDGVIYALE
2ej0D           TSSWARFPANVMPGKAKVGGNYVNSALAKMXXXXXXXXXXXXXXXXXYVAEGSGENLFFV-RDGVIYALE
1wrvC           TSSWARFPANVMPGKAKVGGNYVNSALAKMXXXXXXXXXXXXXXXXXYVAEGSGENLFFV-RDGVIYALE
2ej0E           TSSWARFPANVMPGKAKVGGNYVNSALAKMXXXXXXXXXXXXXXXXXYVAEGSGENLFFV-RDGVIYALE
2eiyC           TSSWARFPANVMPGKAKVGGNYVNSALAKMXXXXXXXXXXXXXXXXXYVAEGSGENLFFV-RDGVIYALE
1wrvA           TSSWARFPANVMPGKAKVGGNYVNSALAKMXXXXXXXXXXXXXXXXXYVAEGSGENLFFV-RDGVIYALE
2ej0F           TSSWARFPANVMPGKAKVGGNYVNSALAKMXXXXXXXXXXXXXXXXXYVAEGSGENLFFV-RDGVIYALE
2ej2E           TSSWARFPANVMPGKAKVGGNYVNSALAKMXXXXXXXXXXXXXXXXXYVAEGSGENLFFV-RDGVIYALE
1daaA           VKATFVEDIRWLRCDIKSLNL-LGAVLAKQEAHEKGCYEAI-LHRNNTVTEGSSSNV-FGIKDGILYTPA
5daaA           VKATFVEDIRWLRCDIKSLNL-LGAVLAKQEAHEKGCYEAIL--HRNNTVTKGSSSNVFGIKDGILYTPA
1a0gB           VKATFVEDIRWLRCDIKSLNL-LGAVLAKQEAHEKGCYEAI-LHRNNTVTEGSSSNV-FGIKDGILYTPA
1a0gA           VKATFVEDIRWLRCDIKSLNL-LGAVLAKQEAHEKGCYEAI-LHRNNTVTEGSSSNV-FGIKDGILYTPA
1g2wA           VKATFVEDIRWLRCDIKSLNL-LGAVLAKQEAHEKGCYEAIL--HRXXXXXXXXXXXXFGIKDGILYTPA
3dtgA           HEYVRASPGGT--GAAKFGGNYXXXXXXXXXXXEMGCDQVVWLDERRYVEEMGGMNLFFVFGSGRLVTPL
3cswC           ISNVRRIPDLSTPPALKITGRTDI-VLARREIVD--CYDVILLGLNGQVCEGSFSNVFLV-KEGKLITPS
3cswA           ISNVRRIPDLSTPPALKITGRTDI-VLARREIVD--CYDVILLGLNGQVCEGSFSNVFLV-KEGKLITPS
1i2kA           LSPVRLGRNPHLAGIKHLNRLEQV--LIRSHLEQTNADEALVLDSEGWVTECCAANLFWR-KGNVVYTPL
2hhfB           IRAWVGGVGN-----YKLGGNYGPTVLVQQEALKRGCEQVLWLDHQLTEVGTMNIFVYWTHEDGVLEPPL
2hdkA           IRAWVGGVGN-----YKLGGNYGPTVLVQQEALKRGCEQVLWLDHQLTEVGTMNIFVYWTHEDGVLEPPL
2hg8B           IRAWVGGVGN-----YKLGGNYGPTVLVQQEALKRGCEQVLWLDHQLTEVGTMNIFVYWTHEDGVLEPPL
1kt8A           IRAWVGGVGN-----YKLGGNYGPTVLVQQEALKRGCEQVLWLDHQLTEVGTMNIFVYWTHEDGVLEPPL
1et0A           LSPVRLGRNPHLAGIKHLNRLEQV--LIRSHLEQTNADEALVLDSEGWVTECCAANLFWR-KGNVVYTPL
1ekfA           IRAWVGGVGN-----YKLGGNYGPTVLVQQEALKRGCEQVLWLDHQLTEVGTMNIFVYWTHEDGVLEPPL
2a1hA           IRAWVGGVGN-----YKLGGNYGPTVLVQQEALKRGCEQVLWLDHQLTEVGTMNIFVYWTHEDGVLEPPL


                         .         .         .         +         .         .         .:280
query           PDSFLDGITRRTVIEIAKSKGIKVNERKIAPAELSNFVGCFLTGTAAEVTPVSCIAENKFxxxxxxxxxx
1iyeA           TSSALPGITRDAIIKLAKELGIEVREQVLSRESLYLADEVFMSGTAAEITPVRSV---------------
1a3gA           TSSALPGITRDAIIKLAKELGIEVREQVLSRESLYLADEVFMSGTAAEITPVRSV---------------
1i1kA           TSSALPGITRDAIIKLAKELGIEVREQVLSRESLYLADEVFMSGTAAEITPVRSV---------------
1wrvB           HSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMI---------------
2eiyB           HSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMI---------------
2ej0D           HSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMI---------------
1wrvC           HSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMI---------------
2ej0E           HSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMI---------------
2eiyC           HSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMI---------------
1wrvA           HSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMI---------------
2ej0F           HSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMI---------------
2ej2E           HSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMI---------------
1daaA           NNMILKGITRDVVIACANEINMPVKEIPFTTHEALKMDELFVTSTTSEITPV------------------
5daaA           NNMILKGITRDVVIACANEINMPVKEIPFTTHEALKMDELFVTSTTSEITPV------------------
1a0gB           NNMIAKGITRDVVIACANEINMPVKEIPFTTHEALKMDELFVTSTTSEITPV------------------
1a0gA           NNMIAKGITRDVVIACANEINMPVKEIPFTTHEALKMDELFVTSTTSEITPV------------------
1g2wA           NNMILKGITRDVVIACANEINMPVKEIPFTTHEALKMDELFVTSTTSEITPV------------------
3dtgA           SGSLLPGITRDSLLQLATDAGFAVEERKIDVDEWQKKAGAFACGTAAVITPVS-----------------
3cswC           LDSILDGITRENVIKLAKSLEIPVEERVVWVWELFE-ADEFLTHTSAGVVPVRRLNEHSF----------
3cswA           LDSILDGITRENVIKLAKSLEIPVEERVVWVWELFE-ADEFLTHTSAGVVPVRRLNEHSF----------
1i2kA           DQAGVNGIMRQFCIRLLAQSSYQLVEVQASLEESLQADEMVICNALMPVMPVCACGDVSF----------
2hhfB           NGVILPGVVRQSLLDMAQTWGFRVVERTITMKQLLRALEVFGSGTACQVCPV------------------
2hdkA           NGVILPGVVRQSLLDMAQTWGFRVVERTITMKQLLRALEVFGSGTAAQVAPV------------------
2hg8B           NGVILPGVVRQSLLDMAQTWGFRVVERTITMKQLLRALEVFGSGTAAQVCPV------------------
1kt8A           NGVILPGVVRQSLLDMAQTWGFRVVERTITMKQLLRALEVFGSGTACQVCPV------------------
1et0A           DQAGVNGIMRQFCIRLLAQSSYQLVEVQASLEESLQADEMVICNALMPVMPVCACGDVSF----------
1ekfA           NGVILPGVVRQSLLDMAQTWGFRVVERTITMKQLLRALEVFGSGTACQVCPV------------------
2a1hA           NGVILPGVVRQSLLDMAQTWGFRVVERTITMKQLLRALEVFGSGTACQVCPV------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxx
1iyeA           -------------
1a3gA           -------------
1i1kA           -------------
1wrvB           -------------
2eiyB           -------------
2ej0D           -------------
1wrvC           -------------
2ej0E           -------------
2eiyC           -------------
1wrvA           -------------
2ej0F           -------------
2ej2E           -------------
1daaA           -------------
5daaA           -------------
1a0gB           -------------
1a0gA           -------------
1g2wA           -------------
3dtgA           -------------
3cswC           -------------
3cswA           -------------
1i2kA           -------------
2hhfB           -------------
2hdkA           -------------
2hg8B           -------------
1kt8A           -------------
1et0A           -------------
1ekfA           -------------
2a1hA           -------------