[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:polA

[Show Plain Result]

#ERROR : Can't open dsspfile "1d9dA.bssp"
#ERROR : Can't open dsspfile "1d8yA.bssp"
#ERROR : Can't open dsspfile "1klnA.bssp"
#ERROR : Can't open dsspfile "1kfdA.bssp"
#ERROR : Can't open dsspfile "1u4bA.bssp"
#ERROR : Can't open dsspfile "1lv5A.bssp"
#ERROR : Can't open dsspfile "1l3sA.bssp"
#ERROR : Can't open dsspfile "2hhqA.bssp"
#ERROR : Can't open dsspfile "2bdpA.bssp"
#ERROR : Can't open dsspfile "2hviA.bssp"
#ERROR : Can't open dsspfile "2hhwA.bssp"
#ERROR : Can't open dsspfile "1bdp-.bssp"
#ERROR : Can't open dsspfile "2hhxA.bssp"
#ERROR : Can't open dsspfile "1qtmA.bssp"
#ERROR : Can't open dsspfile "1qssA.bssp"
#ERROR : Can't open dsspfile "4ktqA.bssp"
#ERROR : Can't open dsspfile "1taqA.bssp"
#ERROR : Can't open dsspfile "1ktqA.bssp"
#ERROR : Can't open dsspfile "1cmwA.bssp"
#ERROR : Can't open dsspfile "1tauA.bssp"
#ERROR : Can't open dsspfile "2ktqA.bssp"
#ERROR : Can't open dsspfile "1jxeA.bssp"
#ERROR : Can't open dsspfile "1bgxT.bssp"
#ERROR : Can't open dsspfile "1tk8A.bssp"
#ERROR : Can't open dsspfile "1tk0A.bssp"
#ERROR : Can't open dsspfile "1zyqA.bssp"
#ERROR : Can't open dsspfile "1x9mA.bssp"
#ERROR : Can't open dsspfile "1t8eA.bssp"
#ERROR : Can't open dsspfile "2ajqF.bssp"
#ERROR : Can't open dsspfile "2ajqA.bssp"
#ERROR : Can't open dsspfile "1ut5B.bssp"
#ERROR : Can't open dsspfile "1ut5A.bssp"
#ERROR : Can't open dsspfile "1tk5A.bssp"
#ERROR : Can't open dsspfile "1x9sA.bssp"
#ERROR : Can't open dsspfile "1t7pA.bssp"
#ERROR : Can't open dsspfile "1sl1A.bssp"
#ERROR : Can't open dsspfile "1skwA.bssp"
#ERROR : Can't open dsspfile "1sksA.bssp"
#ERROR : Can't open dsspfile "1skrA.bssp"
#ERROR : Can't open dsspfile "1sl2A.bssp"
#ERROR : Can't open dsspfile "1xo1A.bssp"
#ERROR : Can't open dsspfile "1sl0C.bssp"
#ERROR : Can't open dsspfile "1tfrA.bssp"
#ERROR : Can't open dsspfile "1sl0A.bssp"
#ERROR : Can't open dsspfile "2ihnA.bssp"
#ERROR : Can't open dsspfile "1exnB.bssp"
#ERROR : Can't open dsspfile "1exnA.bssp"
#ERROR : Can't open dsspfile "1rxvA.bssp"
#ERROR : Can't open dsspfile "1rxwA.bssp"

## Summary of PDB Search
:924
    e-129  42%  1d9dA  [c.55.3 - e.8.1] DNA POLYMERASE I
    e-127  41%  1d8yA  [c.55.3 - e.8.1] DNA POLYMERASE I
    e-124  41%  1klnA  [c.55.3 - e.8.1] PROTEIN (DNA POLYMERASE I KLENOW FRAGMENT
    e-116  41%  1kfdA  [x.x.x] DNA POLYMERASE I KLENOW FRAGMENT
    e-100  44%  1u4bA  [c.55.3 - e.8.1] DNA POLYMERASE I
    e-100  44%  1lv5A  [c.55.3 - e.8.1] DNA POLYMERASE I
    e-100  44%  1l3sA  [c.55.3 - e.8.1] DNA POLYMERASE I
    e-100  44%  2hhqA  [x.x.x] DNA POLYMERASE I
    e-100  44%  2bdpA  [c.55.3 - e.8.1] PROTEIN (DNA POLYMERASE I)
    2e-99  43%  2hviA  [x.x.x] DNA POLYMERASE I
    2e-99  43%  2hhwA  [x.x.x] DNA POLYMERASE I
    8e-98  43%  1bdp-  [x.x.x] DNA POLYMERASE I
    5e-97  43%  2hhxA  [x.x.x] DNA POLYMERASE I
    2e-89  41%  1qtmA  [c.55.3 - e.8.1] DNA POLYMERASE I
    2e-89  41%  1qssA  [c.55.3 - e.8.1] DNA POLYMERASE I
    2e-89  41%  4ktqA  [c.55.3 - e.8.1] PROTEIN (LARGE FRAGMENT OF DNA POLYMERASE I)
    1e-87  40%  1taqA  [x.x.x] TAQ DNA POLYMERASE
    1e-86  41%  1ktqA  [c.55.3 - e.8.1 (5ktqA)] DNA POLYMERASE I
    2e-86  40%  1cmwA  [c.120.1 - a.60.7 - c.55.3 - e.8.1] PROTEIN (DNA POLYMERASE
    5e-86  40%  1tauA  [c.120.1 - a.60.7 - c.55.3 - e.8.1] PROTEIN (TAQ POLYMERASE)
    7e-86  42%  2ktqA  [c.55.3 - e.8.1] PROTEIN (LARGE FRAGMENT OF DNA POLYMERASE I)
    5e-85  42%  1jxeA  [x.x.x] TAQ DNA POLYMERASE I
    1e-82  39%  1bgxT  [c.120.1 - a.60.7 - c.55.3 - e.8.1] TAQ DNA POLYMERASE
    3e-11  24%  1tk8A  [c.55.3 - e.8.1] DNA POLYMERASE
    3e-11  24%  1tk0A  [c.55.3 - e.8.1] DNA POLYMERASE
    4e-11  24%  1zyqA  [x.x.x] DNA POLYMERASE
    6e-11  24%  1x9mA  [c.55.3 - e.8.1] DNA POLYMERASE
    7e-11  24%  1t8eA  [c.55.3 - e.8.1] DNA POLYMERASE
    7e-11  24%  2ajqF  [x.x.x] T7 DNA POLYMERASE
    7e-11  24%  2ajqA  [x.x.x] T7 DNA POLYMERASE
    2e-10  29%  1ut5B  [c.120.1 - a.60.7] EXODEOXYRIBONUCLEASE
    2e-10  29%  1ut5A  [c.120.1 - a.60.7] EXODEOXYRIBONUCLEASE
    2e-10  24%  1tk5A  [c.55.3 - e.8.1] DNA POLYMERASE
    2e-10  24%  1x9sA  [c.55.3 - e.8.1] DNA POLYMERASE
    2e-10  24%  1t7pA  [c.55.3 - e.8.1] PROTEIN (DNA POLYMERASE)
    2e-10  24%  1sl1A  [c.55.3 - e.8.1] DNA POLYMERASE
    2e-10  24%  1skwA  [c.55.3 - e.8.1] DNA POLYMERASE
    2e-10  24%  1sksA  [c.55.3 - e.8.1] DNA POLYMERASE
    2e-10  24%  1skrA  [c.55.3 - e.8.1] DNA POLYMERASE
    3e-08  28%  1sl2A  [c.55.3 - e.8.1] DNA POLYMERASE
    4e-08  28%  1xo1A  [c.120.1 - a.60.7] 5'-EXONUCLEASE
    1e-07  25%  1sl0C  [c.55.3 - e.8.1] DNA POLYMERASE
    1e-07  41%  1tfrA  [x.x.x] T4 RNASE H
    1e-07  28%  1sl0A  [c.55.3 - e.8.1] DNA POLYMERASE
    2e-07  34%  2ihnA  [x.x.x] RIBONUCLEASE H
    2e-07  28%  1exnB  [c.120.1 - a.60.7] 5'-EXONUCLEASE
    2e-07  28%  1exnA  [c.120.1 - a.60.7] 5'-EXONUCLEASE
    2e-04  33%  1rxvA  [c.120.1 - a.60.7] FLAP STRUCTURE-SPECIFIC ENDONUCLEASE
    5e-04  31%  1rxwA  [c.120.1 - a.60.7] FLAP STRUCTURE-SPECIFIC ENDONUCLEASE
:924

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxLIDGSGYIFRAYYALPPLTRKSDGLPVGAVSGFCSMLFKLLEDSKSNENLQKPTHFAVI
1d9dA           ----------------------------------------------------------------------
1d8yA           ----------------------------------------------------------------------
1klnA           ----------------------------------------------------------------------
1kfdA           ----------------------------------------------------------------------
1u4bA           ----------------------------------------------------------------------
1lv5A           ----------------------------------------------------------------------
1l3sA           ----------------------------------------------------------------------
2hhqA           ----------------------------------------------------------------------
2bdpA           ----------------------------------------------------------------------
2hviA           ----------------------------------------------------------------------
2hhwA           ----------------------------------------------------------------------
1bdp-           ----------------------------------------------------------------------
2hhxA           ----------------------------------------------------------------------
1qtmA           ----------------------------------------------------------------------
1qssA           ----------------------------------------------------------------------
4ktqA           ----------------------------------------------------------------------
1taqA           -----------LVDGHHLAYRTFHALKGLTT-SRGEPVQAVYGFAKSLLKALKEDGDA--------VIVV
1ktqA           ----------------------------------------------------------------------
1cmwA           -----------LVDGHHLAYRTFHALKGLTT-SRGEPVQAVYGFAKSLLKALKEDGDA--------VIVV
1tauA           -----------LVDGHHLAYRTFHALKGLTT-SRGEPVQAVYGFAKSLLKALKEDGDA--------VIVV
2ktqA           ----------------------------------------------------------------------
1jxeA           ----------------------------------------------------------------------
1bgxT           -----------LVDGHHLAYRTFHALKGLTT-SRGEPVQAVYGFAKSLLKALKEDGDA--------VIVV
1tk8A           ----------------------------------------------------------------------
1tk0A           ----------------------------------------------------------------------
1zyqA           ----------------------------------------------------------------------
1x9mA           ----------------------------------------------------------------------
1t8eA           ----------------------------------------------------------------------
2ajqF           ----------------------------------------------------------------------
2ajqA           ----------------------------------------------------------------------
1ut5B           --------------------------------------------------------------------VL
1ut5A           --------------------------------------------------------------------VL
1tk5A           ----------------------------------------------------------------------
1x9sA           ----------------------------------------------------------------------
1t7pA           ----------------------------------------------------------------------
1sl1A           ----------------------------------------------------------------------
1skwA           ----------------------------------------------------------------------
1sksA           ----------------------------------------------------------------------
1skrA           ----------------------------------------------------------------------
1sl2A           ----------------------------------------------------------------------
1xo1A           --------------------------------------------------------------------VL
1sl0C           ----------------------------------------------------------------------
1tfrA           ----------------------------------------------------------------------
1sl0A           ----------------------------------------------------------------------
2ihnA           ----------------------------------------------------------------TKIVLC
1exnB           --------------------------------------------------------------------VL
1exnA           --------------------------------------------------------------------VL
1rxvA           ----------------------------------------------------------------------
1rxwA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FDAARKTFRNEIYSDYKANRSEAPDDLAPQFEYIRKSVVAFNLPSVDLPNYEADDLIATYVEQILAKGAK
1d9dA           ----------------------------------------------------------------------
1d8yA           ----------------------------------------------------------------------
1klnA           ----------------------------------------------------------------------
1kfdA           ----------------------------------------------------------------------
1u4bA           ----------------------------------------------------------------------
1lv5A           ----------------------------------------------------------------------
1l3sA           ----------------------------------------------------------------------
2hhqA           ----------------------------------------------------------------------
2bdpA           ----------------------------------------------------------------------
2hviA           ----------------------------------------------------------------------
2hhwA           ----------------------------------------------------------------------
1bdp-           ----------------------------------------------------------------------
2hhxA           ----------------------------------------------------------------------
1qtmA           ----------------------------------------------------------------------
1qssA           ----------------------------------------------------------------------
4ktqA           ----------------------------------------------------------------------
1taqA           FDA----------------RAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYE
1ktqA           ----------------------------------------------------------------------
1cmwA           FDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYE
1tauA           FDA----------------RAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYE
2ktqA           ----------------------------------------------------------------------
1jxeA           ----------------------------------------------------------------------
1bgxT           FDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYE
1tk8A           ----------------------------------------------------------------------
1tk0A           ----------------------------------------------------------------------
1zyqA           ----------------------------------------------------------------------
1x9mA           ----------------------------------------------------------------------
1t8eA           ----------------------------------------------------------------------
2ajqF           ----------------------------------------------------------------------
2ajqA           ----------------------------------------------------------------------
1ut5B           GDKGKSVFRLEHLPEYKGNRDEKYAQRTEEFEYLKDALCKTTFPTFTIRGVEADDMAAYIVKLIGHLYDH
1ut5A           GDKGKSVFRLEHLPEYKGNRDEKYAQRTEEFEYLKDALCKTTFPTFTIRGVEADDMAAYIVKLIGHLYDH
1tk5A           ----------------------------------------------------------------------
1x9sA           ----------------------------------------------------------------------
1t7pA           ----------------------------------------------------------------------
1sl1A           ----------------------------------------------------------------------
1skwA           ----------------------------------------------------------------------
1sksA           ----------------------------------------------------------------------
1skrA           ----------------------------------------------------------------------
1sl2A           ----------------------------------------------------------------------
1xo1A           GDKGKSVFRLEHLPEYAF------------FEYLKDALCKTTFPTFTIRGVEADDMAAYIVKLIGHLYDH
1sl0C           ----------------------------------------------------------------------
1tfrA           ---------------------------------------------MDIDKYEADDHIAVLVKKFSLEGHK
1sl0A           ----------------------------------------------------------------------
2ihnA           IDNAKSGYRRDFAYYYKKNRSTW--DWEGYFESSHKVIDELKMPYIDIDKYEANDHIAVLVKKFSLEGHK
1exnB           GDKGKSVFRLEHLPEYKGNRDEKYAQRTEEFEYLKDALCKTTFPTFTIRGVEADD--AAYIVKLIGHYDH
1exnA           GDKGKSVFRLEHLPEYKGNRDEKYAQRTEEFEYLKDALCKTTFPTFTIRGVEADD--AAYIVKLIGHYDH
1rxvA           -------------------------------EYIAKTLLSYGIPFVDAPS--EGEAQAAYMA---AKGDV
1rxwA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VTIVSSDKDLMQLYRKDVRIFDPMKNKFITPEDIVTKFGVGPEKVIDVQSLAGDSSDNVPGVPGIGVKTA
1d9dA           ----------------------------------------------------------------------
1d8yA           ----------------------------------------------------------------------
1klnA           ----------------------------------------------------------------------
1kfdA           ----------------------------------------------------------------------
1u4bA           ----------------------------------------------------------------------
1lv5A           ----------------------------------------------------------------------
1l3sA           ----------------------------------------------------------------------
2hhqA           ----------------------------------------------------------------------
2bdpA           ----------------------------------------------------------------------
2hviA           ----------------------------------------------------------------------
2hhwA           ----------------------------------------------------------------------
1bdp-           ----------------------------------------------------------------------
2hhxA           ----------------------------------------------------------------------
1qtmA           ----------------------------------------------------------------------
1qssA           ----------------------------------------------------------------------
4ktqA           ----------------------------------------------------------------------
1taqA           VRILTADKDLYQLLSDRIHVLHP-EGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIGEKTA
1ktqA           ----------------------------------------------------------------------
1cmwA           VRILTADKDLYQLLSDRIHVLHP-EGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIGEKTA
1tauA           VRILTADKDLYQLLSDRIHVLHP-EGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIGEKTA
2ktqA           ----------------------------------------------------------------------
1jxeA           ----------------------------------------------------------------------
1bgxT           VRILTADKDLYQLLSDRIHVLHP-EGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIGEKTA
1tk8A           ----------------------------------------------------------------------
1tk0A           ----------------------------------------------------------------------
1zyqA           ----------------------------------------------------------------------
1x9mA           ----------------------------------------------------------------------
1t8eA           ----------------------------------------------------------------------
2ajqF           ----------------------------------------------------------------------
2ajqA           ----------------------------------------------------------------------
1ut5B           VWLISTDGDWDTLLTDKVSRFSFTTRREYHLRDMYEHHNVDDEQFISLKAIMGDLGDNIRGVEGIGAKRG
1ut5A           VWLISTDGDWDTLLTDKVSRFSFTTRREYHLRDMYEHHNVDDEQFISLKAIMGDLGDNIRGVEGIGAKRG
1tk5A           ----------------------------------------------------------------------
1x9sA           ----------------------------------------------------------------------
1t7pA           ----------------------------------------------------------------------
1sl1A           ----------------------------------------------------------------------
1skwA           ----------------------------------------------------------------------
1sksA           ----------------------------------------------------------------------
1skrA           ----------------------------------------------------------------------
1sl2A           ----------------------------------------------------------------------
1xo1A           VWLISTDGDWDTLLTDKVSRFSFTTRREYHLRDMYEHHNVDDEQFISLKAIMGDLGDNIRGVEGIGAKRG
1sl0C           ----------------------------------------------------------------------
1tfrA           ILIISSDGDFTQLHKPNVKQWSPMHKKWV-------KIG-SAEIDCMTKILKGDKKDNVASV--------
1sl0A           ----------------------------------------------------------------------
2ihnA           ILIISSDGDFTQLHKPNVKQWSPMHKKWV-------KIKSGSAEICMTKILKGDKKDNVASV--------
1exnB           VWLISTDGDWDTLLTDKVSRFSFTTRREYHLRDYEHHNVDDVEQFISLKAI-GDLGDNIRGVEGIGAKRG
1exnA           VWLISTDGDWDTLLTDKVSRFSFTTRREYHLRDYEHHNVDDVEQFISLKAI-GDLGDNIRGVEGIGAKRG
1rxvA           EYTGSQDYDSLLFGSPRLARNLAIKPEIIILESNLKRLGLTREQLIDIAILVG--TDYNEGVKGVGVKKA
1rxwA           -----------------------VKPEIIILESNLKRLGLTREQLIDIAILVG--TDYNEGVKGVGVKKA


                         .         .         .         +         .         .         .:280
query           AELINKYGTLEKLLDNAQEIKQNKRRETLIENKDKAIISKKLVTLMKDAPVExxxxxxxxxxxxxxxxxx
1d9dA           ----------------------------------------------------------------------
1d8yA           ----------------------------------------------------------------------
1klnA           ----------------------------------------------------------------------
1kfdA           ----------------------------------------------------------------------
1u4bA           ----------------------------------------------------------------------
1lv5A           ----------------------------------------------------------------------
1l3sA           ----------------------------------------------------------------------
2hhqA           ----------------------------------------------------------------------
2bdpA           ----------------------------------------------------------------------
2hviA           ----------------------------------------------------------------------
2hhwA           ----------------------------------------------------------------------
1bdp-           ----------------------------------------------------------------------
2hhxA           ----------------------------------------------------------------------
1qtmA           ----------------------------------------------------------------------
1qssA           ----------------------------------------------------------------------
4ktqA           ----------------------------------------------------------------------
1taqA           RKLLEEWGSLEALLKNLDRLKP-AIREKILAHMDDLKLSWDLAKVRTDLPLE------------------
1ktqA           ----------------------------------------------------------------------
1cmwA           RKLLEEWGSLEALLKNLDRLKP-AIREKILAHMDDLKLSWDLAKVRTDLPLE------------------
1tauA           RKLLEEWGSLEALLKNLDRLKP-AIREKILAHMDDLKLSWDLAKVRTDLPLE------------------
2ktqA           ----------------------------------------------------------------------
1jxeA           ----------------------------------------------------------------------
1bgxT           RKLLEEWGSLEALLKNLDRLKP-AIREKILAHMDDLKLSWDLAKVRTDLPLE------------------
1tk8A           ----------------------------------------------------------------------
1tk0A           ----------------------------------------------------------------------
1zyqA           ----------------------------------------------------------------------
1x9mA           ----------------------------------------------------------------------
1t8eA           ----------------------------------------------------------------------
2ajqF           ----------------------------------------------------------------------
2ajqA           ----------------------------------------------------------------------
1ut5B           YNIIREFGNVLDIID-------------------------------------------------------
1ut5A           YNIIREFGNVLDIID-------------------------------------------------------
1tk5A           ----------------------------------------------------------------------
1x9sA           ----------------------------------------------------------------------
1t7pA           ----------------------------------------------------------------------
1sl1A           ----------------------------------------------------------------------
1skwA           ----------------------------------------------------------------------
1sksA           ----------------------------------------------------------------------
1skrA           ----------------------------------------------------------------------
1sl2A           ----------------------------------------------------------------------
1xo1A           YNIIREFGNVLDIID-------------------------------------------------------
1sl0C           ----------------------------------------------------------------------
1tfrA           ----------------------------------------------------------------------
1sl0A           ----------------------------------------------------------------------
2ihnA           ----------------------------------------------------------------------
1exnB           YNIIREFGNVLDIID-------------------------------------------------------
1exnA           YNIIREFGNVLDIID-------------------------------------------------------
1rxvA           LNYIKTYGDIFRALDHVEEIR-------------------------------------------------
1rxwA           LNYIKTYGDIFRALKALKVVEE------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxISKKNYHLITNEKEIDEWINEAEEAGELAIDT
1d9dA           --------------------------------------ISYDNYVTILDEETLKAWIAKLEKAPVFAFDT
1d8yA           --------------------------------------ISYDNYVTILDEETLKAWIAKLEKAPVFAFAT
1klnA           --------------------------------------ISYDNYVTILDEETLKAWIAKLEKAPVFAFAT
1kfdA           --------------------------------------ISYDNYVTILDEETLKAWIAKLEKAPVFAFDT
1u4bA           ----------------------------------------------------------------------
1lv5A           ----------------------------------------------------------------------
1l3sA           ----------------------------------------------------------------------
2hhqA           ----------------------------------------------------------------------
2bdpA           ----------------------------------------------------------------------
2hviA           ----------------------------------------------------------------------
2hhwA           ----------------------------------------------------------------------
1bdp-           ----------------------------------------------------------------------
2hhxA           ----------------------------------------------------------------------
1qtmA           ----------------------------------------------------------------------
1qssA           ----------------------------------------------------------------------
4ktqA           ----------------------------------------------------------------------
1taqA           ----------------------------------------------------------------------
1ktqA           ----------------------------------------------------------------------
1cmwA           ----------------------------------------------------------------------
1tauA           ----------------------------------------------------------------------
2ktqA           ----------------------------------------------------------------------
1jxeA           ----------------------------------------------------------------------
1bgxT           ----------------------------------------------------------------------
1tk8A           ----------------------------------------------------------------------
1tk0A           ----------------------------------------------------------------------
1zyqA           ----------------------------------------------------------------------
1x9mA           ----------------------------------------------------------------------
1t8eA           ----------------------------------------------------------------------
2ajqF           ----------------------------------------------------------------------
2ajqA           ----------------------------------------------------------------------
1ut5B           ----------------------------------------------------------------------
1ut5A           ----------------------------------------------------------------------
1tk5A           ----------------------------------------------------------------------
1x9sA           ----------------------------------------------------------------------
1t7pA           ----------------------------------------------------------------------
1sl1A           ----------------------------------------------------------------------
1skwA           ----------------------------------------------------------------------
1sksA           ----------------------------------------------------------------------
1skrA           ----------------------------------------------------------------------
1sl2A           ----------------------------------------------------------------------
1xo1A           ----------------------------------------------------------------------
1sl0C           ----------------------------------------------------------------------
1tfrA           ----------------------------------------------------------------------
1sl0A           ----------------------------------------------------------------------
2ihnA           ----------------------------------------------------------------------
1exnB           ----------------------------------------------------------------------
1exnA           ----------------------------------------------------------------------
1rxvA           ----------------------------------------------------------------------
1rxwA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ETSSLDAHQTDLVGISLSTKIGQACYIPIGHKFKGCLKKETVIKKLKPLLEDKSVKKIGQNIKFDFIVLY
1d9dA           ETDSLDNISANLVGLSFAIEPGVAAYIPVAHDYLDAISRERAXXXXXXXXXXXXXXXVGQNLKYDRGILA
1d8yA           ATDSLDNISANLVGLSFAIEPGVAAYIPVAHDYLDAISRERAXXXXXXXXXXXXXXXVGQNLKYDRGILA
1klnA           ETDSLDNISANLVGLSFAIEPGVAAYIPVAHDYLDAISRERAXXXXXXXXXXXXXXXVGQNLKYDRGILA
1kfdA           ETDSLDNISANLVGLSFAIEPGVAAYIPVAHDYLDAISRERAXXXXXXXXXXXXXXXVGQNLKYDRGILA
1u4bA           ----------------------------------------------------------------------
1lv5A           ----------------------------------------------------------------------
1l3sA           ----------------------------------------------------------------------
2hhqA           ----------------------------------------------------------------------
2bdpA           ----------------------------------------------------------------------
2hviA           ----------------------------------------------------------------------
2hhwA           ----------------------------------------------------------------------
1bdp-           ----------------------------------------------------------------------
2hhxA           ----------------------------------------------------------------------
1qtmA           ----------------------------------------------------------------------
1qssA           ----------------------------------------------------------------------
4ktqA           ----------------------------------------------------------------------
1taqA           ----------------------------------------------------------------------
1ktqA           ----------------------------------------------------------------------
1cmwA           ----------------------------------------------------------------------
1tauA           ----------------------------------------------------------------------
2ktqA           ----------------------------------------------------------------------
1jxeA           ----------------------------------------------------------------------
1bgxT           ----------------------------------------------------------------------
1tk8A           ----------------------------------------------------------------------
1tk0A           ----------------------------------------------------------------------
1zyqA           ----------------------------------------------------------------------
1x9mA           ----------------------------------------------------------------------
1t8eA           ----------------------------------------------------------------------
2ajqF           ----------------------------------------------------------------------
2ajqA           ----------------------------------------------------------------------
1ut5B           ----------------------------------------------------------------------
1ut5A           ----------------------------------------------------------------------
1tk5A           ----------------------------------------------------------------------
1x9sA           ----------------------------------------------------------------------
1t7pA           ----------------------------------------------------------------------
1sl1A           ----------------------------------------------------------------------
1skwA           ----------------------------------------------------------------------
1sksA           ----------------------------------------------------------------------
1skrA           ----------------------------------------------------------------------
1sl2A           ----------------------------------------------------------------------
1xo1A           ----------------------------------------------------------------------
1sl0C           ----------------------------------------------------------------------
1tfrA           ----------------------------------------------------------------------
1sl0A           ----------------------------------------------------------------------
2ihnA           ----------------------------------------------------------------------
1exnB           ----------------------------------------------------------------------
1exnA           ----------------------------------------------------------------------
1rxvA           ----------------------------------------------------------------------
1rxwA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KQGINMNSMEDTMLMSYVLDAGKNRHNMDTLSEIHLQHKTISFKEIVGTGKKEINFSDVELDKAMEYAAE
1d9dA           NYGIELRGIADTMLESYILNSVAGRHDMDSLAERWLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAE
1d8yA           NYGIELRGIADTMLESYILNSVAGRHDMDSLAERWLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAE
1klnA           NYGIELRGIADTMLESYILNSVAGRHDMDSLAERWLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAE
1kfdA           NYGIELRGIADTMLESYILNSVAGRHDMDSLAERWLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAE
1u4bA           -----------------------------------------------------------------EHLVR
1lv5A           -----------------------------------------------------------------EHLVR
1l3sA           -----------------------------------------------------------------EHLVR
2hhqA           -----------------------------------------------------------------EHLVR
2bdpA           -----------------------------------------------------------------EHLVR
2hviA           -----------------------------------------------------------------EHLVR
2hhwA           -----------------------------------------------------------------EHLVR
1bdp-           -----------------------------------------------------------------EHLVR
2hhxA           -----------------------------------------------------------------EHLVR
1qtmA           ----------------------------------------------------------------------
1qssA           ----------------------------------------------------------------------
4ktqA           ----------------------------------------------------------------------
1taqA           ----------------------------------------------------------------------
1ktqA           ----------------------------------------------------------------------
1cmwA           ----------------------------------------------------------------------
1tauA           ----------------------------------------------------------------------
2ktqA           ----------------------------------------------------------------------
1jxeA           ----------------------------------------------------------------------
1bgxT           ----------------------------------------------------------------------
1tk8A           ----------------------------------------------------------------------
1tk0A           ----------------------------------------------------------------------
1zyqA           ----------------------------------------------------------------------
1x9mA           ----------------------------------------------------------------------
1t8eA           ----------------------------------------------------------------------
2ajqF           ----------------------------------------------------------------------
2ajqA           ----------------------------------------------------------------------
1ut5B           ----------------------------------------------------------------------
1ut5A           ----------------------------------------------------------------------
1tk5A           ----------------------------------------------------------------------
1x9sA           ----------------------------------------------------------------------
1t7pA           ----------------------------------------------------------------------
1sl1A           ----------------------------------------------------------------------
1skwA           ----------------------------------------------------------------------
1sksA           ----------------------------------------------------------------------
1skrA           ----------------------------------------------------------------------
1sl2A           ----------------------------------------------------------------------
1xo1A           ----------------------------------------------------------------------
1sl0C           ----------------------------------------------------------------------
1tfrA           ----------------------------------------------------------------------
1sl0A           ----------------------------------------------------------------------
2ihnA           ----------------------------------------------------------------------
1exnB           ----------------------------------------------------------------------
1exnA           ----------------------------------------------------------------------
1rxvA           ----------------------------------------------------------------------
1rxwA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DADITYRLYKIFSKNLKLEKLTNIYEIFEKPLIKILAFMEIEGIKIDNKFLKVLSEKFEKKISKLEKEVF
1d9dA           DADVTLQLHKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEKKAH
1d8yA           DADVTLQLHKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEKKAH
1klnA           DADVTLQLHKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEKKAH
1kfdA           DADVTLQLHKMWPDLQKHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEKKAH
1u4bA           KAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIY
1lv5A           KAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIY
1l3sA           KAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIY
2hhqA           KAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIY
2bdpA           KAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIY
2hviA           KAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIY
2hhwA           KAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIY
1bdp-           KAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELREKLGTVEQRIY
2hhxA           KAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIY
1qtmA           ------------------------YREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVF
1qssA           ------------------------YREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVF
4ktqA           ------------------------YREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVF
1taqA           ------------------------YREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVF
1ktqA           ------------------------YREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVF
1cmwA           ------------------------YREVERPLSAVLAHMEATGVRLDVAYLRALSLEVA-----LEAEVF
1tauA           ------------------------YREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVF
2ktqA           ------------------------YREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVF
1jxeA           ------------------------YREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVF
1bgxT           ------------------------YREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVF
1tk8A           ----------------------------------------------------------------------
1tk0A           ----------------------------------------------------------------------
1zyqA           ----------------------------------------------------------------------
1x9mA           ----------------------------------------------------------------------
1t8eA           ----------------------------------------------------------------------
2ajqF           ----------------------------------------------------------------------
2ajqA           ----------------------------------------------------------------------
1ut5B           ----------------------------------------------------------------------
1ut5A           ----------------------------------------------------------------------
1tk5A           ----------------------------------------------------------------------
1x9sA           ----------------------------------------------------------------------
1t7pA           ----------------------------------------------------------------------
1sl1A           ----------------------------------------------------------------------
1skwA           ----------------------------------------------------------------------
1sksA           ----------------------------------------------------------------------
1skrA           ----------------------------------------------------------------------
1sl2A           ----------------------------------------------------------------------
1xo1A           ----------------------------------------------------------------------
1sl0C           ----------------------------------------------------------------------
1tfrA           ----------------------------------------------------------------------
1sl0A           ----------------------------------------------------------------------
2ihnA           ----------------------------------------------------------------------
1exnB           ----------------------------------------------------------------------
1exnA           ----------------------------------------------------------------------
1rxvA           ----------------------------------------------------------------------
1rxwA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           KISKKEFNIASPKQLGEIIYNDLKIAVLKKTRKGSFATNASVLEDLAFKGHEFPKLILDWRQVSKLKNTY
1d9dA           EIAGEEFNLSSTKQLQTILFEKQGIKPLKKTP----STSEEVLEELALD-YPLPKVILEYRGLAKLKSTY
1d8yA           EIAGEEFNLSSTKQLQTILFEKQGIKPLKKTP----STSEEVLEELALD-YPLPKVILEYRGLAKLKSTY
1klnA           EIAGEEFNLSS--QLQTILFEKQGIKPLK--------TSEEVLEELALD-YPLPKVILEYRGLAKLKSTY
1kfdA           EIAD----------------------------------------------YPLPKVILEYRGLAKLKSTY
1u4bA           ELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTG-YSTSADVLEKLA-PYHEIVENILHYRQLGKLQSTY
1lv5A           ELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTG-YSTSADVLEKLA-PYHEIVENILHYRQLGKLQSTY
1l3sA           ELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTG-YSTSADVLEKLA-PYHEIVENILHYRQLGKLQSTY
2hhqA           ELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTG-YSTSADVLEKLA-PYHEIVENILHYRQLGKLQSTY
2bdpA           ELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTG-YSTSADVLEKLA-PYHEIVENILHYRQLGKLQSTY
2hviA           ELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTG-YSTSADVLEKLA-PYHEIVENILHYRQLGKLQSTY
2hhwA           ELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTG-YSTSADVLEKLA-PYHEIVENILHYRQLGKLQSTY
1bdp-           ELAGQEFNINSPKQLGVILFEKLQLPVL-------YSTSADVLEKLA-PYHEIVENILHYRQLGKLQSTY
2hhxA           ELAGQEFNINSPKQLGVILFEKLQLPVL------GYSTSADVLEKLA-PYHEIVENILHYRQLGKLQSTY
1qtmA           RLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKGKRSTSAAVLEALR-EAHPIVEKILQYRELTKLKSTY
1qssA           RLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKGKRSTSAAVLEALR-EAHPIVEKILQYRELTKLKSTY
4ktqA           RLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKGKRSTSAAVLEALR-EAHPIVEKILQYRELTKLKSTY
1taqA           RLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKGKRSTSAAVLEALR-EAHPIVEKILQYRELTKLKSTY
1ktqA           RLAGHPFNLNSRDQLERVLFDELGLPAI--------STSAAVLEALR-EAHPIVEKILQYRELTKLKSTY
1cmwA           RLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKGKRSTSAAVLEALR-EAHPIVEKILQYRELTKLKSTY
1tauA           RLAGHPFNLNSRDQLERVLFDEL-------------STSAAVLEALR-EAHPIVEKILQYRELTKLKSTY
2ktqA           RLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKGKRSTSAAVLEALR-EAHPIVEKILQYRELTKLKSTY
1jxeA           RLAGHPFNLNSRDQLERVLFDELGLA--------------AVLEALR-EAHPIVEKILQYRELTKLKSTY
1bgxT           RLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKGKRSTSAAVLEALR-EAHPIVEKILQYRELTKLKSTY
1tk8A           ----------------------------------------------------------------------
1tk0A           ----------------------------------------------------------------------
1zyqA           ----------------------------------------------------------------------
1x9mA           ----------------------------------------------------------------------
1t8eA           ----------------------------------------------------------------------
2ajqF           ----------------------------------------------------------------------
2ajqA           ----------------------------------------------------------------------
1ut5B           ----------------------------------------------------------------------
1ut5A           ----------------------------------------------------------------------
1tk5A           ----------------------------------------------------------------------
1x9sA           ----------------------------------------------------------------------
1t7pA           ----------------------------------------------------------------------
1sl1A           ----------------------------------------------------------------------
1skwA           ----------------------------------------------------------------------
1sksA           ----------------------------------------------------------------------
1skrA           ----------------------------------------------------------------------
1sl2A           ----------------------------------------------------------------------
1xo1A           ----------------------------------------------------------------------
1sl0C           ----------------------------------------------------------------------
1tfrA           ----------------------------------------------------------------------
1sl0A           ----------------------------------------------------------------------
2ihnA           ----------------------------------------------------------------------
1exnB           ----------------------------------------------------------------------
1exnA           ----------------------------------------------------------------------
1rxvA           ----------------------------------------------------------------------
1rxwA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           SDALPEHINPNTKRVHTSFLLAATTTGRLASSDPNLQNIPIKSEDGKDIRKAFIAEKGFTLISADYNQIE
1d9dA           TDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRRIRQAFIAPEDYVIVSADYSQIE
1d8yA           TDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRRIRQAFIAPEDYVIVSADYSQIE
1klnA           TDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRRIRQAFIAPEDYVIVSADYSQIE
1kfdA           TDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRRIRQAFIAPEDYVIVSADYSQIE
1u4bA           IEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVSESDWLIFAADYSQIE
1lv5A           IEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVSESDWLIFAADYSQIE
1l3sA           IEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVSESDWLIFAADYSQIE
2hhqA           IEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVSESDWLIFAADYSQIE
2bdpA           IEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVSESDWLIFAADYSQIE
2hviA           IEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVSESDWLIFAADYSQIE
2hhwA           IEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVSESDWLIFAADYSQIE
1bdp-           IEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVSESDWLIFAADYSQIE
2hhxA           IEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVSESDWLIFAADYSQIE
1qtmA           IDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIE
1qssA           IDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIE
4ktqA           IDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIE
1taqA           IDPLPDLIHPRTGRLHTRFNQTATATGRLCCCDPNLQNIPVRTPLGQRIRRGFIAEEGWLLVALDYSQIE
1ktqA           IDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIE
1cmwA           IDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIE
1tauA           IDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIE
2ktqA           IDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIE
1jxeA           IDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIE
1bgxT           IDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIE
1tk8A           -------------KIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFGAEKPWVQAGIDASGLE
1tk0A           -------------KIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFGAEKPWVQAGIDASGLE
1zyqA           -------------KIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFGAEKPWVQAGIDASGLE
1x9mA           -------------KIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFGAEKPWVQAGIDASGLE
1t8eA           -------------KIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFGAEKPWVQAGIDASGLE
2ajqF           -------------KIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFGAEKPWVQAGIDASGLE
2ajqA           -------------KIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFGAEKPWVQAGIDASGLE
1ut5B           ----------------------------------------------------------------------
1ut5A           ----------------------------------------------------------------------
1tk5A           -------------KIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFGAEKPWVQAGIDASGLE
1x9sA           -------------KIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFGAEKPWVQAGIDASGLE
1t7pA           -------------KIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFGAEKPWVQAGIDASGLE
1sl1A           -------------KIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFGAEKPWVQAGIDASGLE
1skwA           -------------KIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFGAEKPWVQAGIDASGLE
1sksA           -------------KIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFGAEKPWVQAGIDASGLE
1skrA           -------------KIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFGAEKPWVQAGIDASGLE
1sl2A           -------------KIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFGAEKPWVQAGIDASGLE
1xo1A           ----------------------------------------------------------------------
1sl0C           -------------KIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFGAEKPWVQAGIDASGLE
1tfrA           ----------------------------------------------------------------------
1sl0A           -------------KIHGSVNPNGAVTGRATHAFPNLAQIPVRSPYGEQCRAAFGAEKPWVQAGIDASGLE
2ihnA           ----------------------------------------------------------------------
1exnB           ----------------------------------------------------------------------
1exnA           ----------------------------------------------------------------------
1rxvA           ----------------------------------------------------------------------
1rxwA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           MRILADLAEVKELKKAFSNNEDIHSLTASQVFNVDIKKVDQDMRRKAKAINFGIIYGISQYGLAKQINVS
1d9dA           LRIMAHLSRDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINFGLIYGMSAFGLARQLNIP
1d8yA           LRIMAHLSRDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINFGLIYGMSAFGLARQLNIP
1klnA           LRIMAHLSRDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINFGLIYGMSAFGLARQLNIP
1kfdA           LRIMAHLSRDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINFGLIYGMSAFGLARQLNIP
1u4bA           LRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNIS
1lv5A           LRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNIS
1l3sA           LRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNIS
2hhqA           LRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNIS
2bdpA           LRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNIS
2hviA           LRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNIS
2hhwA           LRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNIS
1bdp-           LRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNIS
2hhxA           LRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNIS
1qtmA           LRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIP
1qssA           LRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIP
4ktqA           LRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIP
1taqA           LRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIP
1ktqA           LRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIP
1cmwA           LRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIP
1tauA           LRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIP
2ktqA           LRVLAHLSGDENLIRVFQEGRDIHTETAS----------DPLMRRAAKTINFGVLYGMSAHRLSQELAIP
1jxeA           LRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIP
1bgxT           LRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIP
1tk8A           LRCLA------HFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAG
1tk0A           LRCLA------HFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAG
1zyqA           LRCLA------HFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEAIGQIVGAG
1x9mA           LRCLA------HFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAG
1t8eA           LRCLA------HFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAG
2ajqF           LRCLA------HFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAG
2ajqA           LRCLA------HFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAG
1ut5B           ----------------------------------------------------------------------
1ut5A           ----------------------------------------------------------------------
1tk5A           LRCLA------HFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYG----AIGQIVGAG
1x9sA           LRCLA------HFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAG
1t7pA           LRCLA------HFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAG
1sl1A           LRCLA------HFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAG
1skwA           LRCLA------HFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAG
1sksA           LRCLA------HFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAG
1skrA           LRCLA------HFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAG
1sl2A           LRCLA------HFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYD-EKIG---QIVGA
1xo1A           ----------------------------------------------------------------------
1sl0C           LRCLA------HFMARFDNGEYAH-----EILNGDIHTKNQIAAELPTRDNKTFIYG---FKIGQIVGAG
1tfrA           ----------------------------------------------------------------------
1sl0A           LRCLA------HFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFKIG--------QIVGA
2ihnA           ----------------------------------------------------------------------
1exnB           ----------------------------------------------------------------------
1exnA           ----------------------------------------------------------------------
1rxvA           ----------------------------------------------------------------------
1rxwA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           NHEADEFLNAYFLKFPEIKIYMDNTIKFCRKSGYVTNIFGRRSHFNGINDKNFNVRNFQERAAINAPIQG
1d9dA           RKEAQKYMDLYFERYPGVLEYMERTRAQAKEQGYVETLDGRRLYLPDIKSSNGXXXXXXXXXXINAPMQG
1d8yA           RKEAQKYMDLYFERYPGVLEYMERTRAQAKEQGYVETLDGRRLYLPDIKSSNGXXXXXXXXXXINAPMQG
1klnA           RKEAQKYMDLYFERYPGVLEYMERTRAQAKEQGYVETLDGRRLYLPDIKSSNGXXXXXXXXXXINAPMQG
1kfdA           RKEAQKYMDLYFERYPGVLEYMERTRAQAKEQGYVETLDGRRLYLPDIKSSNGXXXXXXXXXXINAPMQG
1u4bA           RKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQG
1lv5A           RKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQG
1l3sA           RKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQG
2hhqA           RKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQG
2bdpA           RKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQG
2hviA           RKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQG
2hhwA           RKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQG
1bdp-           RKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQG
2hhxA           RKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQG
1qtmA           YEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQG
1qssA           YEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQG
4ktqA           YEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQG
1taqA           YEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQG
1ktqA           YEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQG
1cmwA           YEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQG
1tauA           YEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQG
2ktqA           YEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQG
1jxeA           YEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQG
1bgxT           YEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQG
1tk8A           KERGKELKKKFLENTPAIAALRESIQQTLVESS--QQVKWKRRWIKGLDGRKVHVRS--PHAALNTLLQS
1tk0A           KERGKELKKKFLENTPAIAALRESIQQTLVESS--QQVKWKRRWIKGLDGRKVHVRS--PHAALNTLLQS
1zyqA           KERGKELKKKFLENTPAIAALRESIQQLVESSQWVAQVKWKRRWIKGLDGRKVHVRS--PHAALNTLLQS
1x9mA           KERGKELKKKFLENTPAIAALRESI------QQTLVEVKWKRRWIKGLDGRKVHVRS--PHAALNTLLQS
1t8eA           KERGKELKKKFLENTPAIAALRESIQQLVESSQWVAQVKWKRRWIKGLDGRKVHVRS--PHAALNTLLQS
2ajqF           KERGKELKKKFLENTPAIAALRESIQQLVESSQWVAQVKWKRRWIKGLDGRKVHVRS--PHAALNTLLQS
2ajqA           KERGKELKKKFLENTPAIAALRESIQQLVESSQWVAQVKWKRRWIKGLDGRKVHVRS--PHAALNTLLQS
1ut5B           ----------------------------------------------------------------------
1ut5A           ----------------------------------------------------------------------
1tk5A           KERGKELKKKFLENTPAIAALRESI-----QQTLVESVKWKRRWIKGLDGRKVHVRS--PHAALNTLLQS
1x9sA           KERGKELKKKFLENTPAIAALRESIQQTLVEK-------WKRRWIKGLDGRKVHVRS--PHAALNTLLQS
1t7pA           KERGKELKKKFLENTPAIAALRESIQQTLVEK-------WKRRWIKGLDGRKVHVRS--PHAALNTLLQS
1sl1A           KERGKELKKKFLENTPAIAALRESIQQTLVEK-------WKRRWIKGLDGRKVHVRS--PHAALNTLLQS
1skwA           KERGKELKKKFLENTPAIAALRESIQQTLVEK-------WKRRWIKGLDGRKVHVRS--PHAALNTLLQS
1sksA           KERGKELKKKFLENTPAIAALRESIQQTLVEK-------WKRRWIKGLDGRKVHVRS--PHAALNTLLQS
1skrA           KERGKELKKKFLENTPAIAALRESIQQTLVEK-------WKRRWIKGLDGRKVHVRS--PHAALNTLLQS
1sl2A           GKERGKELK---------KKFLENTIAALRESIQQTLVKWKRRWIKGLDGRKVHVRS--PHAALNTLLQS
1xo1A           ----------------------------------------------------------------------
1sl0C           KERGKELKKKFLENTPAIAALRESIQQTLVEK-------WKRRWIKGLDGRKVHVRS--PHAALNTLLQS
1tfrA           ----------------------------------------------------------------------
1sl0A           GKERGKELK---------KKFLENTIAALRESIQQTLVKWKRRWIKGLDGRKVHVRS--PHAALNTLLQS
2ihnA           ----------------------------------------------------------------------
1exnB           ----------------------------------------------------------------------
1exnA           ----------------------------------------------------------------------
1rxvA           ----------------------------------------------------------------------
1rxwA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           SASEIMRLAMIRLNKKFESIKNNKSKILLQIHDELIFEVPVKEVKNITEIIKDEMTSVTESDLHTFSTPL
1d9dA           TAADIIKRAMIAVDAWLQA-EQPRVRMIMQVHDELVFEVHKDDVDAVAKQIHQLMENCTRLDV-----PL
1d8yA           TAADIIKRAMIAVDAWLQA-EQPRVRMIMQVHDELVFEVHKDDVDAVAKQIHQLMENCTRLDV-----PL
1klnA           TAADIIKRAMIAVDAWLQA-EQPRVRMIMQVHDELVFEVHKDDVDAVAKQIHQLMENCTRLDV-----PL
1kfdA           TAADIIKRAMIAVDAWLQA-EQPRVRMIMQVHDELVFEVHKDDVDAVAKQIHQLMENCTRLDV-----PL
1u4bA           SAADIIKKAMIDLNARLKE-ERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV-----TLRVPL
1lv5A           SAADIIKKAMIDLNARLKE-ERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV-----TLRVPL
1l3sA           SAADIIKKAMIDLNARLKE-ERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV-----TLRVPL
2hhqA           SAADIIKKAMIDLNARLKE-ERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV-----TLRVPL
2bdpA           SAADIIKKAMIDLNARLKE-ERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV-----TLRVPL
2hviA           SAADIIKKAMIDLNARLKE-ERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV-----TLRVPL
2hhwA           SAADIIKKAMIDLNARLKE-ERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV-----TLRVPL
1bdp-           SAADIIKKAMIDLNARLKE-ERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV-----TLRVPL
2hhxA           SAADIIKKAMIDLNARLKE-ERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV-----TLRVPL
1qtmA           TAADLMKLAMVKL---FPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGV-----YPLAVPL
1qssA           TAADLMKLAMVKL---FPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGV-----YPLAVPL
4ktqA           TAADLMKLAMVKL---FPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGV-----YPLAVPL
1taqA           TAADLMKLAMVKL---FPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGV-----YPLAVPL
1ktqA           TAADLMKLAMVKL---FPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGV-----YPLAVPL
1cmwA           TAADLMKLAMVKL---FPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGV-----YPLAVPL
1tauA           TAADLMKLAMVKL---FPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGV-----YPLAVPL
2ktqA           TAADLMKLAMVKL---FPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGV-----YPLAVPL
1jxeA           TAADLMKLAMVKL---FPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGV-----YPLAVPL
1bgxT           TAADLMKLAMVKL---FPRLEEMGARMLLQVHDXXXXXXXXXXXXXXXXXME---------GVYPLAVPL
1tk8A           AGALICKLWIIKVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVETAQEAMRWV--GDHWNFRCLL
1tk0A           AGALICKLWIIKVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVETAQEAMRWV--GDHWNFRCLL
1zyqA           AGALICKLWIIKVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVETAQEAMRWV--GDHWNFRCLL
1x9mA           AGALICKLWIIKVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVETAQEAMRWV--GDHWNFRCLL
1t8eA           AGALICKLWIIKVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVETAQEAMRWV--GDHWNFRCLL
2ajqF           AGALICKLWIIKVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVETAQEAMRWV--GDHWNFRCLL
2ajqA           AGALICKLWIIKVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVETAQEAMRWV--GDHWNFRCLL
1ut5B           ----------------------------------------------------------------------
1ut5A           ----------------------------------------------------------------------
1tk5A           AGALICKLWIIKVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVETAQEAMRWV--GDHWNFRCLL
1x9sA           AGALICKLWIIKVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVETAQEAMRWV--GDHWNFRCLL
1t7pA           AGALICKLWIIKVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVETAQEAMRWV--GDHWNFRCLL
1sl1A           AGALICKLWIIKVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVETAQEAMRWV--GDHWNFRCLL
1skwA           AGALICKLWIIKVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVETAQEAMRWV--GDHWNFRCLL
1sksA           AGALICKLWIIKVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVETAQEAMRWV--GDHWNFRCLL
1skrA           AGALICKLWIIKVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVETAQEAMRWV--GDHWNFRCLL
1sl2A           AGALICKLWIIKVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVETAQEAMRWV--GDHWNFRCLL
1xo1A           ----------------------------------------------------------------------
1sl0C           AGALICKLWIIKVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVETAQEAMRWV--GDHWNFRCLL
1tfrA           ----------------------------------------------------------------------
1sl0A           AGALICKLWIIKVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVETAQEAMRWV--GDHWNFRCLL
2ihnA           ----------------------------------------------------------------------
1exnB           ----------------------------------------------------------------------
1exnA           ----------------------------------------------------------------------
1rxvA           ----------------------------------------------------------------------
1rxwA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           TVDVNTGDNWGILH
1d9dA           LVEVGSGENWDQAH
1d8yA           LVEVGSGENWDQAH
1klnA           LVEVGSGENWDQAH
1kfdA           LVEVGSGENWDQAH
1u4bA           KVDYHYGSTW----
1lv5A           KVDYHYGSTW----
1l3sA           KVDYHYGSTW----
2hhqA           KVDYHYGSTW----
2bdpA           KVDYHYGSTW----
2hviA           KVDYHYGSTW----
2hhwA           KVDYHYGSTW----
1bdp-           KVDYHYGSTW----
2hhxA           KVDYHYGSTW----
1qtmA           EVEVGIGEDW----
1qssA           EVEVGIGEDW----
4ktqA           EVEVGIGEDW----
1taqA           EVEVGIGEDW----
1ktqA           EVEVGIGEDW----
1cmwA           EVEVGIGEDW----
1tauA           EVEVGIGEDW----
2ktqA           EVEVGIGEDW----
1jxeA           EVEVGIGEDW----
1bgxT           EVEVGIGEDW----
1tk8A           DTEGKMGPNWAICH
1tk0A           DTEGKMGPNWAICH
1zyqA           DTEGKMGPNWAICH
1x9mA           DTEGKMGPNWAICH
1t8eA           DTEGKMGPNWAICH
2ajqF           DTEGKMGPNWAICH
2ajqA           DTEGKMGPNWAICH
1ut5B           --------------
1ut5A           --------------
1tk5A           DTEGKMGPNWAICH
1x9sA           DTEGKMGPNWAICH
1t7pA           DTEGKMGPNWAICH
1sl1A           DTEGKMGPNWAICH
1skwA           DTEGKMGPNWAICH
1sksA           DTEGKMGPNWAICH
1skrA           DTEGKMGPNWAICH
1sl2A           DTEGKMGPNWAICH
1xo1A           --------------
1sl0C           DTEGKMGPNWAICH
1tfrA           --------------
1sl0A           DTEGKMGPNWAICH
2ihnA           --------------
1exnB           --------------
1exnA           --------------
1rxvA           --------------
1rxwA           --------------