[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:sucA

[Show Plain Result]

#ERROR : Can't open dsspfile "2jgdA.bssp"
#ERROR : Can't open dsspfile "2jgdB.bssp"
#ERROR : Can't open dsspfile "3exeE.bssp"
#ERROR : Can't open dsspfile "3exeC.bssp"
#ERROR : Can't open dsspfile "3exeA.bssp"
#ERROR : Can't open dsspfile "2ozlA.bssp"
#ERROR : Can't open dsspfile "3exhC.bssp"
#ERROR : Can't open dsspfile "3exfC.bssp"
#ERROR : Can't open dsspfile "3exfA.bssp"
#ERROR : Can't open dsspfile "3exhA.bssp"
#ERROR : Can't open dsspfile "1ni4A.bssp"
#ERROR : Can't open dsspfile "3exgW.bssp"
#ERROR : Can't open dsspfile "3exgI.bssp"
#ERROR : Can't open dsspfile "3exgE.bssp"
#ERROR : Can't open dsspfile "3exgA.bssp"
#ERROR : Can't open dsspfile "3exgS.bssp"
#ERROR : Can't open dsspfile "3exgU.bssp"
#ERROR : Can't open dsspfile "3exgG.bssp"
#ERROR : Can't open dsspfile "3exgK.bssp"
#ERROR : Can't open dsspfile "3exg3.bssp"
#ERROR : Can't open dsspfile "1w85G.bssp"
#ERROR : Can't open dsspfile "1w85C.bssp"
#ERROR : Can't open dsspfile "3exg1.bssp"

## Summary of PDB Search
:967
      0.0  49%  2jgdA  [x.x.x] 2-OXOGLUTARATE DEHYDROGENASE E1 COMPONENT
      0.0  48%  2jgdB  [x.x.x] 2-OXOGLUTARATE DEHYDROGENASE E1 COMPONENT
    1e-09  31%  3exeE  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-09  31%  3exeC  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-09  31%  3exeA  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-09  31%  2ozlA  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT ALPHA
    3e-09  30%  3exhC  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    6e-09  30%  3exfC  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    6e-09  30%  3exfA  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-07  31%  3exhA  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    2e-07  33%  1ni4A  [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT: ALPHA
    1e-05  28%  3exgW  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    5e-05  32%  3exgI  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    5e-05  28%  3exgE  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    6e-05  29%  3exgA  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-04  32%  3exgS  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    2e-04  28%  3exgU  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    2e-04  28%  3exgG  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    3e-04  30%  3exgK  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    4e-04  29%  3exg3  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    7e-04  23%  1w85G  [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
    7e-04  23%  1w85C  [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
    7e-04  29%  3exg1  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
:967

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2jgdA           ----------------------------------------------------------------------
2jgdB           ----------------------------------------------------------------------
3exeE           ----------------------------------------------------------------------
3exeC           ----------------------------------------------------------------------
3exeA           ----------------------------------------------------------------------
2ozlA           ----------------------------------------------------------------------
3exhC           ----------------------------------------------------------------------
3exfC           ----------------------------------------------------------------------
3exfA           ----------------------------------------------------------------------
3exhA           ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
3exgW           ----------------------------------------------------------------------
3exgI           ----------------------------------------------------------------------
3exgE           ----------------------------------------------------------------------
3exgA           ----------------------------------------------------------------------
3exgS           ----------------------------------------------------------------------
3exgU           ----------------------------------------------------------------------
3exgG           ----------------------------------------------------------------------
3exgK           ----------------------------------------------------------------------
3exg3           ----------------------------------------------------------------------
1w85G           ----------------------------------------------------------------------
1w85C           ----------------------------------------------------------------------
3exg1           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSNINSIRAVALIRAYRQRGHLLAKLDPLGMMETEYLDE
2jgdA           --------------------------------TNVKQVKVLQLINAYRFRGHQHANLDPLGLWQQ---DD
2jgdB           --------------------------------TNVKQVKVLQLINAYRFRGHQHANLDPLGLWKVADLD-
3exeE           ----------------------------------------------------------------------
3exeC           ----------------------------------------------------------------------
3exeA           ----------------------------------------------------------------------
2ozlA           ----------------------------------------------------------------------
3exhC           ----------------------------------------------------------------------
3exfC           ----------------------------------------------------------------------
3exfA           ----------------------------------------------------------------------
3exhA           ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
3exgW           ----------------------------------------------------------------------
3exgI           ----------------------------------------------------------------------
3exgE           ----------------------------------------------------------------------
3exgA           ----------------------------------------------------------------------
3exgS           ----------------------------------------------------------------------
3exgU           ----------------------------------------------------------------------
3exgG           ----------------------------------------------------------------------
3exgK           ----------------------------------------------------------------------
3exg3           ----------------------------------------------------------------------
1w85G           ----------------------------------------------------------------------
1w85C           ----------------------------------------------------------------------
3exg1           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LHPEHYGFKKENYDEKIYLDGVINKEHSSIKEILNFLNKTYCGPIGYEYMHISNPTERKWLRDRIEQDEN
2jgdA           LDPSFHDLT-EDFQETFNVGSFA--ETMKLGELLEALKQTYCGPIGAEYMHITSTEEKRWIQQRIE---S
2jgdB           --PSFHDLTEADFQETFNVGSFASKETMKLGELLEALKQTYCGPIGAEYMHITSTEEKRWIQQRIESGRA
3exeE           ----------------------------------------------------------------------
3exeC           ----------------------------------------------------------------------
3exeA           ----------------------------------------------------------------------
2ozlA           ----------------------------------------------------------------------
3exhC           ----------------------------------------------------------------------
3exfC           ----------------------------------------------------------------------
3exfA           ----------------------------------------------------------------------
3exhA           ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
3exgW           ----------------------------------------------------------------------
3exgI           ----------------------------------------------------------------------
3exgE           ----------------------------------------------------------------------
3exgA           ----------------------------------------------------------------------
3exgS           ----------------------------------------------------------------------
3exgU           ----------------------------------------------------------------------
3exgG           ----------------------------------------------------------------------
3exgK           ----------------------------------------------------------------------
3exg3           ----------------------------------------------------------------------
1w85G           ----------------------------------------------------------------------
1w85C           ----------------------------------------------------------------------
3exg1           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SLQFTKNGKEAILMKLIQAEGFEKFLHKKYVGTKRFGLDGGEGLIPALEQIIKIGGQAKVKEVKIGMSHR
2jgdA           RATFNSEEKKRFLSELTAAEGLERYLGAKFPG--RFSLEGGDALIPMLKEMIRHAGNSGTREVVLGMAHR
2jgdB           T--FNSEEKKRFLSELTAAEGLERYLGAKF---PRFSLEGGDALIPMLKEMIRHAGNSGTREVVLGMAHR
3exeE           ----------------------------------------------------------------------
3exeC           ----------------------------------------------------------------------
3exeA           ----------------------------------------------------------------------
2ozlA           ----------------------------------------------------------------------
3exhC           ----------------------------------------------------------------------
3exfC           ----------------------------------------------------------------------
3exfA           ----------------------------------------------------------------------
3exhA           ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
3exgW           ----------------------------------------------------------------------
3exgI           ----------------------------------------------------------------------
3exgE           ----------------------------------------------------------------------
3exgA           ----------------------------------------------------------------------
3exgS           ----------------------------------------------------------------------
3exgU           ----------------------------------------------------------------------
3exgG           ----------------------------------------------------------------------
3exgK           ----------------------------------------------------------------------
3exg3           ----------------------------------------------------------------------
1w85G           ----------------------------------------------------------------------
1w85C           ----------------------------------------------------------------------
3exg1           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GRLNVLANVLQKSYKRIFNEFAGDIQTSGEEGAGDVKYHLGASSNREFDGNSVHVSLTDNPSHLEAVNPV
2jgdA           GRLNVLVNVLGKKPQDLFDEFAGKHHL----GTGDVKYHMGFSSDFQTDGGLVHLALAFNPSHLEIVSPV
2jgdB           GRLNVLVNVLGKKPQDLFDEFAG------KHGTGDVKYHMGFSSDFQTDGGLVHLALAFNPSHLEIVSPV
3exeE           --------------------------------------------------------------------PL
3exeC           --------------------------------------------------------------------PL
3exeA           --------------------------------------------------------------------PL
2ozlA           --------------------------------------------------------------------PL
3exhC           --------------------------------------------------------------------PL
3exfC           --------------------------------------------------------------------PL
3exfA           --------------------------------------------------------------------PL
3exhA           --------------------------------------------------------------------PL
1ni4A           --------------------------------------------------------------------PL
3exgW           --------------------------------------------------------------------PL
3exgI           --------------------------------------------------------------------PL
3exgE           --------------------------------------------------------------------PL
3exgA           --------------------------------------------------------------------PL
3exgS           --------------------------------------------------------------------PL
3exgU           --------------------------------------------------------------------PL
3exgG           --------------------------------------------------------------------PL
3exgK           --------------------------------------------------------------------PL
3exg3           --------------------------------------------------------------------PL
1w85G           ----------------------------------------------------------------------
1w85C           ----------------------------------------------------------------------
3exg1           --------------------------------------------------------------------PL


                         .         .         .         .         *         .         .:420
query           VLGQTRAKQFFHKDKERNKVIPILIHGDAAFAGQGVVTECFAMSGLPGHNTGGTIHIIVNNQIGFTTSPR
2jgdA           VIGSVRARLDRLDEPSSNKVLPITIHGDAAVTGQGVVQETLNMSKARGYEVGGTVRIVINNQ--------
2jgdB           VIGSVRARLDRLDEPSSNKVLPITIHGDAAVTGQGVVQETLNMSKARGYEVGGTVRIVINNQ--------
3exeE           GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRYGMGTSVE
3exeC           GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRYGMGTSVE
3exeA           GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRYGMGTSVE
2ozlA           GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRYGMGTSVE
3exhC           GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRYGMGTAVE
3exfC           GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRYGMGTAVE
3exfA           GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRYGMGTAVE
3exhA           GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRYGM--GER
1ni4A           GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYALWKLP------CIFICENNRYGGTSVER
3exgW           GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRRAAASTDY
3exgI           GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRV-----ER
3exgE           GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRRAAASTDY
3exgA           GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRRAAASTDY
3exgS           GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRAAAST---
3exgU           GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRRAAASTDY
3exgG           GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRRAAASTDY
3exgK           GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRAAAST---
3exg3           GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRERAAASTD
1w85G           ------------------------------------------------------IFVVQNNRFAISTPVE
1w85C           ------------------------------------------------------IFVVQNNRFAISTPVE
3exg1           GAGIALACKYNGKDE-----VCLTLYGDGA-ANQGQIFEAYNMAALP------CIFICENNRRAAASTDY


                         .         .         +         .         .         .         .:490
query           FARSSPYPSDVAKMVDAPILHVNGDDPEAVVYATRIATEFRLKFNRDVVVDLICYRRFGHNEGDEPSFTQ
2jgdA           ------YCTDIGKMVQAPIFHVNADDPEAVAFVTRLALDFRNTFKRDVFIDLVCYRRH-----------Q
2jgdB           ------YCTDIGKMVQAPIFHVNADDPEAVAFVTRLALDFRNTFKRDVFIDLVCYRRH------------
3exeE           RAAAS---TDYYKRGDIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPVSYRT
3exeC           RAAAS---TDYYKRGDIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPVSYRT
3exeA           RAAAS---TDYYKRGDIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPVSYRT
2ozlA           RAAAS---TDYYKRGDIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHEMSDPVSYRT
3exhC           RAAAS---TDYYKRGDIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHMSDPGVAYRT
3exfC           RAAAS---TDYYKRGDIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPVAYRT
3exfA           RAAAS---TDYYKRGDIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPVAYRT
3exhA           AAASTDY----YKRGDIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPVAYRT
1ni4A           AAASTDY----YKRGDIPGLRVDGD-----ILCVREATRFAAAYCRSPILELQTYRYHGHSSDPGVSYRT
3exgW           YKRGDFIPG----------LRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHAYRTREE-----
3exgI           AAASTDY----YKRGDIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHTREEIQE-----
3exgE           YKRGDFIPG----------LRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRY--HDPGVAYRTRE
3exgA           YKRGDFIPG----------LRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHTREEIQE-----
3exgS           ---------DYYKRGDIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHTREEIQE-----
3exgU           YKRGDFIPG----------LRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYR---YHPGVAYRTRE
3exgG           YKRGDFIPG----------LRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRHVAYRTREE-----
3exgK           ---------DYYKRGDIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYR---YHPGVAYRTRE
3exg3           YYKRGDF---------IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYR-----------YTR
1w85G           KQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTSGDDPTRYR
1w85C           KQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTSGDDPTRYR
3exg1           YKRGDFIPG----------LRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRY-------------


                         *         .         .         .         .         +         .:560
query           PLMYKKIRSHPTPVEMYGKKLVNENTLSESELSKFKTDFKNLLDDQYKNAKDYKPKIEWYEGTWSRYKPE
2jgdA           PLMYQKIKKHPTPRKIYADKLEQEKVATLEDATEMVNLYRDALDAGDCVVAEWRP-MNMHSFTWSPYLNH
2jgdB           ---YQKIKKHPTPRKIYADKLEQEKVATLEDATEMVNLYRDALDAGDCVVAEWRP-MNMHSFTWSPYLNH
3exeE           REEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
3exeC           REEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
3exeA           REEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
2ozlA           REEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
3exhC           REEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
3exfC           REEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
3exfA           REEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
3exhA           REEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
1ni4A           REEIQEVRSKSDPILL--KDRVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
3exgW           ---IQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
3exgI           ------VRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
3exgE           EI--QEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
3exgA           ------VRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
3exgS           ------VRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
3exgU           EI--QEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
3exgG           ---IQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
3exgK           EI--QEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
3exg3           EEI-QEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------
1w85G           SKELENEWAKKDPLVRFRKFLEAKGLWSEEE---------------------------------------
1w85C           SKELENEWAKKDPLVRFRKFLEAKGLWSEEE---------------------------------------
3exg1           -----EVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFAADPEPPLE------------


                         .         .         .         *         .         .         .:630
query           KGKDKRGVSGYDQQKLLEISEKINATPEKLKLHKTIVKILDARKASVSNGKGIDWSTAEALAFGSLLEEG
2jgdA           EW-DEEYPNKVEMKRLQELAKRISTVPEAVEMQSRVAKIYGDRQAMAAGEKLFDWGGAENLAYATLVDEG
2jgdB           EW-DEEYPNKVEMKRLQELAKRISTVPEAVEMQSRVAKIYADRQAMAAGEKLFDWGGAENLAYATLVDEG
3exeE           ----------------------------------------------------------------------
3exeC           ----------------------------------------------------------------------
3exeA           ----------------------------------------------------------------------
2ozlA           ----------------------------------------------------------------------
3exhC           ----------------------------------------------------------------------
3exfC           ----------------------------------------------------------------------
3exfA           ----------------------------------------------------------------------
3exhA           ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
3exgW           ----------------------------------------------------------------------
3exgI           ----------------------------------------------------------------------
3exgE           ----------------------------------------------------------------------
3exgA           ----------------------------------------------------------------------
3exgS           ----------------------------------------------------------------------
3exgU           ----------------------------------------------------------------------
3exgG           ----------------------------------------------------------------------
3exgK           ----------------------------------------------------------------------
3exg3           ----------------------------------------------------------------------
1w85G           ----------------------------------------------------------------------
1w85C           ----------------------------------------------------------------------
3exg1           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           YPVRLVGQDSGRGTFSQRHSVLRNQEDNSRYIPLNNISKNQMRYEIVDSFLSELAVLGFEYGYSLVEPNT
2jgdA           IPVRLSGEDSGRGTFFHRHAVIHNQSNGSTYTPLQHIHNGQGAFRVWDSVLSEEAVLAFEYGYATAEPRT
2jgdB           IPVRLSGEDSGRGTFFHRHAVIHNQSNGSTYTPLQHIHNGQGAFRVWDS--SEEAVLAFEYGYATAEPRT
3exeE           ----------------------------------------------------------------------
3exeC           ----------------------------------------------------------------------
3exeA           ----------------------------------------------------------------------
2ozlA           ----------------------------------------------------------------------
3exhC           ----------------------------------------------------------------------
3exfC           ----------------------------------------------------------------------
3exfA           ----------------------------------------------------------------------
3exhA           ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
3exgW           ----------------------------------------------------------------------
3exgI           ----------------------------------------------------------------------
3exgE           ----------------------------------------------------------------------
3exgA           ----------------------------------------------------------------------
3exgS           ----------------------------------------------------------------------
3exgU           ----------------------------------------------------------------------
3exgG           ----------------------------------------------------------------------
3exgK           ----------------------------------------------------------------------
3exg3           ----------------------------------------------------------------------
1w85G           ----------------------------------------------------------------------
1w85C           ----------------------------------------------------------------------
3exg1           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           LTIWEAQFGDFANGAQVVIDQFIASGERKWTRASGLVMLLPHGYEGQGPEHSSARLERFLQLCANDNLQV
2jgdA           LTIWEAQFGDFANGAQVVIDQFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCAEQNMQV
2jgdB           LTIWEAQFGDFANGAQVVIDQFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCAEQNMQV
3exeE           ----------------------------------------------------------------------
3exeC           ----------------------------------------------------------------------
3exeA           ----------------------------------------------------------------------
2ozlA           ----------------------------------------------------------------------
3exhC           ----------------------------------------------------------------------
3exfC           ----------------------------------------------------------------------
3exfA           ----------------------------------------------------------------------
3exhA           ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
3exgW           ----------------------------------------------------------------------
3exgI           ----------------------------------------------------------------------
3exgE           ----------------------------------------------------------------------
3exgA           ----------------------------------------------------------------------
3exgS           ----------------------------------------------------------------------
3exgU           ----------------------------------------------------------------------
3exgG           ----------------------------------------------------------------------
3exgK           ----------------------------------------------------------------------
3exg3           ----------------------------------------------------------------------
1w85G           ----------------------------------------------------------------------
1w85C           ----------------------------------------------------------------------
3exg1           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LNCTTPANYYHALRRQMHREFRKPLIIMTPKSLLRNKHCVSNIEDFGKDNFFHRILWDHALDEENGFIKL
2jgdA           CVPSTPAQVYHMLRRQALRGMRRPLVVMSPKSLLRHPLAVSSLEELANGTFLPAI----------GEIDE
2jgdB           CVPSTPAQVYHMLRRQALRGMRRPLVVMSPKSLLRHPLAVSSLEELANGTFLPAI----------GEIDE
3exeE           ----------------------------------------------------------------------
3exeC           ----------------------------------------------------------------------
3exeA           ----------------------------------------------------------------------
2ozlA           ----------------------------------------------------------------------
3exhC           ----------------------------------------------------------------------
3exfC           ----------------------------------------------------------------------
3exfA           ----------------------------------------------------------------------
3exhA           ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
3exgW           ----------------------------------------------------------------------
3exgI           ----------------------------------------------------------------------
3exgE           ----------------------------------------------------------------------
3exgA           ----------------------------------------------------------------------
3exgS           ----------------------------------------------------------------------
3exgU           ----------------------------------------------------------------------
3exgG           ----------------------------------------------------------------------
3exgK           ----------------------------------------------------------------------
3exg3           ----------------------------------------------------------------------
1w85G           ----------------------------------------------------------------------
1w85C           ----------------------------------------------------------------------
3exg1           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           KESSKIKKVILCSGKVYFDLLEAREKLKKDDVVLYRIEQLYPFPVKSLVREIKKYAKNANFYWCQEEPKN
2jgdA           LDPKGVKRVVMCSGKVYYDLLEQRRKNNQHDVAIVRIEQLYPFPHKAMQEVLQQFAHVKDFVWCQEEPLN
2jgdB           LDPKGVKRVVMCSGKVYYDLLEQRRKNNQHDVAIVRIEQLYPFPHKAMQEVLQQFAHVKDFVWCQEEPLN
3exeE           ----------------------------------------------------------------------
3exeC           ----------------------------------------------------------------------
3exeA           ----------------------------------------------------------------------
2ozlA           ----------------------------------------------------------------------
3exhC           ----------------------------------------------------------------------
3exfC           ----------------------------------------------------------------------
3exfA           ----------------------------------------------------------------------
3exhA           ----------------------------------------------------------------------
1ni4A           ----------------------------------------------------------------------
3exgW           ----------------------------------------------------------------------
3exgI           ----------------------------------------------------------------------
3exgE           ----------------------------------------------------------------------
3exgA           ----------------------------------------------------------------------
3exgS           ----------------------------------------------------------------------
3exgU           ----------------------------------------------------------------------
3exgG           ----------------------------------------------------------------------
3exgK           ----------------------------------------------------------------------
3exg3           ----------------------------------------------------------------------
1w85G           ----------------------------------------------------------------------
1w85C           ----------------------------------------------------------------------
3exg1           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           MGAWFSVRDYIQWTLETINANNTGISYIGRSPDASPATGYAKRHLAQQQEIIxxxxx
2jgdA           QGAWYCSQHHFREVIPF----GASLRYAGRPASASPAVGHMSVHQKQQQDLV-----
2jgdB           QGAWYCSQHHFREVIPF----GASLRYAGRPASASPAVGYMSVHQKQQQDLV-----
3exeE           ---------------------------------------------------------
3exeC           ---------------------------------------------------------
3exeA           ---------------------------------------------------------
2ozlA           ---------------------------------------------------------
3exhC           ---------------------------------------------------------
3exfC           ---------------------------------------------------------
3exfA           ---------------------------------------------------------
3exhA           ---------------------------------------------------------
1ni4A           ---------------------------------------------------------
3exgW           ---------------------------------------------------------
3exgI           ---------------------------------------------------------
3exgE           ---------------------------------------------------------
3exgA           ---------------------------------------------------------
3exgS           ---------------------------------------------------------
3exgU           ---------------------------------------------------------
3exgG           ---------------------------------------------------------
3exgK           ---------------------------------------------------------
3exg3           ---------------------------------------------------------
1w85G           ---------------------------------------------------------
1w85C           ---------------------------------------------------------
3exg1           ---------------------------------------------------------