[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for pubi0:glcE

[Show Plain Result]

#ERROR : Can't open dsspfile "2uuuC.bssp"
#ERROR : Can't open dsspfile "2uuuB.bssp"
#ERROR : Can't open dsspfile "2uuvD.bssp"
#ERROR : Can't open dsspfile "2uuvA.bssp"
#ERROR : Can't open dsspfile "2uuuA.bssp"
#ERROR : Can't open dsspfile "2uuvB.bssp"
#ERROR : Can't open dsspfile "2uuuD.bssp"
#ERROR : Can't open dsspfile "2uuvC.bssp"
#ERROR : Can't open dsspfile "2yvsA.bssp"

## Summary of PDB Search
:422
    7e-06  26%  2uuuC  [x.x.x] ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE
    7e-06  26%  2uuuB  [x.x.x] ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE
    5e-05  26%  2uuvD  [x.x.x] ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE
    5e-05  26%  2uuvA  [x.x.x] ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE
    5e-05  26%  2uuuA  [x.x.x] ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE
    6e-05  27%  2uuvB  [x.x.x] ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE
    6e-05  27%  2uuuD  [x.x.x] ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE
    3e-04  27%  2uuvC  [x.x.x] ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE
    4e-04  52%  2yvsA  [x.x.x] GLYCOLATE OXIDASE SUBUNIT GLCE
:422

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxPEDELQVSNLVQELYKKNQPTEIIGTGSKNFIGNNIQSAKKLSMSKLSGVIEYL
2uuuC           ----------------PHSHEEVERLVQLAHKYNVVIIPMGGGS-NIVGSNERFTVSIDMRRMNKVLWVD
2uuuB           ----------------PHSHEEVERLVQLAHKYNVVIIPMGGGS-NIVGSNERFTVSIDMRRMNKVLWVD
2uuvD           ----------------PHSHEEVERLVQLAHKYNVVIIPMGGGS-NIVGSNERFTVSIDMRRMNKVLWVD
2uuvA           ----------------PHSHEEVERLVQLAHKYNVVIIPMGGGS-NIVGSNERFTVSIDMRRMNKVLWVD
2uuuA           ----------------PHSHEEVERLVQLAHKYNVVIIPMGGGS-NIVGSNERFTVSIDMRRMNKVLWVD
2uuvB           ----------------PHSHEEVERLVQLAHKYNVVIIPMGGGS-NIVGSNERFTVSIDMRRMNKVLWVD
2uuuD           ----------------PHSHEEVERLVQLAHKYNVVIIPMGGGS-NIVGSNERFTVSIDMRRMNKVLWVD
2uuvC           ----------------PHSHEEVERLVQLAHKYNVVIIPMGGGS-NIVGA-IEPVERFTVSRMNKVLWVD
2yvsA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PEELYIKVKANTPXXXXXXXXXXXXXXXAFEPIDFGFIENGKSNKGTIAGHLACNFAGSRRFKVGSLRDH
2uuuC           RREMTACIQVGIMGPELEKQLHKQGVSLGHDPDSFEF--------STLGGWLATCSSGHQSDKYGDIEDM
2uuuB           RREMTACIQVGIMGPELEKQLHKQGVSLGHDPDSFEF--------STLGGWLATCSSGHQSDKYGDIEDM
2uuvD           RREMTACIQVGIMGPELEKQLHKQGVSLGHDPDSFEF--------STLGGWLATCSSGHQSDKYGDIEDM
2uuvA           RREMTACIQVGIMGPELEKQLHKQGVSLGHDPDSFEF--------STLGGWLATCSSGHQSDKYGDIEDM
2uuuA           RREMTACIQVGIMGPELEKQLHKQGVSLGHDPDSFEF--------STLGGWLATCSSGHQSDKYGDIEDM
2uuvB           RREMTACIQVGIMGPELEKQLHKQGVSLGHDPDSFEF--------STLGGWLATCSSGHQSDKYGDIEDM
2uuuD           RREMTACIQVGIMGPELEKQLHKQGVSLGHDPDSFEF--------STLGGWLATCSSGHQSDKYGDIEDM
2uuvC           RREMTACIQVGIMGPELEKQLHKQGVSLGHDPDSFEF--------STLGGWLATCSSGHQSDKYGDIEDM
2yvsA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ILGFRGVNGKGDIIKSGGTVVKNVTGYDLSKLVTGSFGTLVALTEITLKVLPxxxxxxxxxxxxxxxxxx
2uuuC           AVSFRTVTPTGTL------ELRNGAGINYKHIILGSEGTLGIITEAVMKV--------------------
2uuuB           AVSFRTVTPTGTL------ELRNGAGINYKHIILGSEGTLGIITEAVMKV--------------------
2uuvD           AVSFRTVTPTGTL---------ELRGINYKHIILGSEGTLGIITEAVMKV--------------------
2uuvA           AVSFRTVTPTGTL---------ELRGINYKHIILGSEGTLGIITEAVMKV--------------------
2uuuA           AVSFRTVTPTGTL---------ELRGINYKHIILGSEGTLGIITEAVMKV--------------------
2uuvB           AVSFRTVTPTGTLELRAGINYKHI--------ILGSEGTLGIITEAVMKV--------------------
2uuuD           AVSFRTVTPTGTLELRAGINYKHI--------ILGSEGTLGIITEAVMKV--------------------
2uuvC           AVSFRTVTPTGTLELRAGINYKHI--------ILGSEGTLGIITEAVMKV--------------------
2yvsA           ---------------------KNVQGYDLVRLFVGSFGLLGRAEEVVLRLRP------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2uuuC           ----------------------------------------------------------------------
2uuuB           ----------------------------------------------------------------------
2uuvD           ----------------------------------------------------------------------
2uuvA           ----------------------------------------------------------------------
2uuuA           ----------------------------------------------------------------------
2uuvB           ----------------------------------------------------------------------
2uuuD           ----------------------------------------------------------------------
2uuvC           ----------------------------------------------------------------------
2yvsA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2uuuC           ----------------------------------------------------------------------
2uuuB           ----------------------------------------------------------------------
2uuvD           ----------------------------------------------------------------------
2uuvA           ----------------------------------------------------------------------
2uuuA           ----------------------------------------------------------------------
2uuvB           ----------------------------------------------------------------------
2uuuD           ----------------------------------------------------------------------
2uuvC           ----------------------------------------------------------------------
2yvsA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2uuuC           ----------------------------------------------------------------------
2uuuB           ----------------------------------------------------------------------
2uuvD           ----------------------------------------------------------------------
2uuvA           ----------------------------------------------------------------------
2uuuA           ----------------------------------------------------------------------
2uuvB           ----------------------------------------------------------------------
2uuuD           ----------------------------------------------------------------------
2uuvC           ----------------------------------------------------------------------
2yvsA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xx
2uuuC           --
2uuuB           --
2uuvD           --
2uuvA           --
2uuuA           --
2uuvB           --
2uuuD           --
2uuvC           --
2yvsA           --